KEGG   Camelina sativa (false flax): 104777430Help
Entry
104777430         CDS       T05044                                 

Definition
(RefSeq) dihydrolipoyllysine-residue acetyltransferase component 5 of pyruvate dehydrogenase complex, chloroplastic isoform X2
  KO
K00627  pyruvate dehydrogenase E2 component (dihydrolipoamide acetyltransferase) [EC:2.3.1.12]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00010  Glycolysis / Gluconeogenesis
csat00020  Citrate cycle (TCA cycle)
csat00620  Pyruvate metabolism
csat01100  Metabolic pathways
csat01110  Biosynthesis of secondary metabolites
csat01200  Carbon metabolism
Module
csat_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csat00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    104777430
   00020 Citrate cycle (TCA cycle)
    104777430
   00620 Pyruvate metabolism
    104777430
Enzymes [BR:csat01000]
 2. Transferases
  2.3  Acyltransferases
   2.3.1  Transferring groups other than aminoacyl groups
    2.3.1.12  dihydrolipoyllysine-residue acetyltransferase
     104777430
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 2-oxoacid_dh Biotin_lipoyl E3_binding GCV_H
Motif
Other DBs
NCBI-GeneID: 104777430
NCBI-ProteinID: XP_010499994
LinkDB All DBs
Position
3
AA seq 465 aa AA seqDB search
MSRLLQTPFLPSVSLPTKTRSSVPGFRVKPRTIPIQAKIREIFMPALSSTMTEGKIVSWV
KSEGDKLNKGESVVVVESDKADMDVETFYDGYLAAIMVEEGGVAPVGSAIALLAETEDEI
ADAKAKASGGGDSKPPPPPPPASPPTPAVESPVAVEKKVAAPVSVKAVAASSVHPASEGG
KRIVASPYAKKLAKELKVELAGLVGSGPMGRIVAKDVEAVSAGGGVQAAVAVKEVAAAPG
VELGSVVPFTTMQGAVSRNMVESLAVPTFRVGYTITTDALDALYKKIKSKGVTMTALLAK
ATALALAKHPVVNSSCRDGNSFVYNSSINVAVAVAIDGGLITPVLQNADKVDIYSLSRKW
KELVDKARAKQLQPQEYNTGTFTLSNLGMFGVDRFDAILPPGTGAIMAVGASQPSTVATK
DGRIGMKNQMQVNVTADHRVIYGADLAQFLQTLASIIEDPKDLTF
NT seq 1398 nt NT seq  +upstreamnt  +downstreamnt
atgtctcgtcttctccaaacacccttcttaccctccgtgtctctccccacaaaaacacga
tcttccgttccgggtttccgggtaaagccccggaccatcccaatccaagcaaagatccga
gaaatcttcatgcctgcactaagttccacgatgaccgaaggcaaaatcgtctcttgggtt
aaatccgaaggcgataagctcaacaagggagagagtgttgtcgttgttgaatccgataaa
gctgatatggacgttgagaccttttacgacggttacctcgctgcaatcatggttgaagaa
ggtggtgttgctcccgttggttcagctattgctttgttagctgagactgaggatgagatc
gctgatgctaaggctaaagcttccggtggtggtgattctaagcctcctcctcctcctcct
ccggcttctcctccgactcctgcagttgaatcacctgtggctgttgagaagaaggttgcg
gctcccgtgtcggttaaggctgtggctgcgtcttcggtgcatccggcgtctgaaggaggg
aagaggattgttgcgtctccgtatgctaagaagttagctaaggaattgaaggttgagttg
gctggtttggttggaagtggaccgatgggaaggattgtggctaaagatgttgaggcggtt
tcagctggaggaggagttcaagctgccgtagctgttaaggaggtagcggcagctcctggt
gtggagctgggatcggtggttccgtttacgacaatgcagggtgctgtgagtaggaatatg
gtggagagtcttgcggttcctacttttagagttggatacacgatcactactgatgctctt
gatgctctctacaagaagattaagtcgaaaggtgtgacaatgacggcactcctagcaaag
gcaactgcactcgcactggcaaaacatccagttgtaaactcttcctgtagagatggtaac
agttttgtgtataacagtagcataaacgttgctgttgctgttgctattgatggtggtctg
atcactccagtgcttcagaacgctgataaggttgacatttattcattgtctagaaaatgg
aaagaattggttgataaggcccgagccaagcagctacagcctcaggagtacaacactggt
accttcactctatctaaccttggaatgtttggcgtcgatcggtttgatgccattctaccc
cctggaactggagcaattatggctgtaggagcatctcaaccttcaacggttgctactaaa
gacggacgcattggcatgaaaaaccagatgcaggtgaatgtgacagcagatcatcgtgtc
atctatggtgctgatctcgcacagttcttgcaaacattggcaagcattattgaggaccca
aaggacctgacattttag

DBGET integrated database retrieval system