KEGG   Camelina sativa (false flax): 104781372Help
Entry
104781372         CDS       T05044                                 

Definition
(RefSeq) protein TONNEAU 1b-like isoform X1
  KO
K16546  FGFR1 oncogene partner
Organism
csat  Camelina sativa (false flax)
Brite
KEGG Orthology (KO) [BR:csat00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csat03036]
    104781372
Chromosome and associated proteins [BR:csat03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Pericentriolar materials (PCM)
    Other PCM proteins
     104781372
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: LisH_2 FOP_dimer
Motif
Other DBs
NCBI-GeneID: 104781372
NCBI-ProteinID: XP_010504334
LinkDB All DBs
Position
4
AA seq 255 aa AA seqDB search
MDDYTREMMDLKTLVTRTLEKKGVLAKIRAELRASVFDAIEEEDRVIENNEGLPPALLGS
CNDRARQLHASPSGRLLSALICEYLDWAQLNHTLKVYQPECNSAKDFWKSEVRDFSSNSV
YELNRNGDSRPLLLDVLEGFLKFENMTQVMGGNSRRESETEPSSSNSRNPPRRSSASDSL
PPQRRPVSASQASGTATSEYRKDEYNWRNDSEDVPEEVMRASTALENLQLDRKTRNLTSS
WRNVGDGTSEEEGKD
NT seq 768 nt NT seq  +upstreamnt  +downstreamnt
atggacgattatacaagagagatgatggatctcaagaccttggtcactcgaacccttgag
aagaaaggtgttctcgctaagatccgggctgagctccgtgcgagtgtgtttgacgcaatt
gaagaagaggatagagtgatagagaacaatgaaggacttcctccagctttgttgggaagc
tgtaatgatcgtgcaaggcagcttcatgcttctccttcaggcaggttgctatctgcgtta
atttgtgaatatttggattgggcgcaacttaatcacactctcaaagtttatcaaccagaa
tgcaattcggcaaaagatttttggaagtctgaggtgcgtgactttagtagcaacagtgtt
tatgagctcaacagaaatggagatagcagacctcttcttctggatgttcttgaaggattc
ttgaagttcgagaacatgacgcaggtcatgggtggtaactcaaggagagagtccgaaacg
gagccctcatcgagcaactcaagaaatcctcctcgcagatcatctgcttctgatagctta
cctcctcaacgaaggccggtttctgcatctcaagcatcgggaaccgctacctctgagtac
agaaaagacgaatacaattggagaaacgacagtgaagatgtgccggaagaagtgatgaga
gcttcgacggcactggaaaatctccagctcgacaggaaaactcggaacctaacatcatct
tggaggaatgtgggggatggaacaagtgaagaagaagggaaagattga

DBGET integrated database retrieval system