KEGG   Camelina sativa (false flax): 104786904Help
Entry
104786904         CDS       T05044                                 

Definition
(RefSeq) superoxide dismutase [Cu-Zn] 2, chloroplastic
  KO
K04565  superoxide dismutase, Cu-Zn family [EC:1.15.1.1]
Organism
csat  Camelina sativa (false flax)
Pathway
csat04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:csat00001]
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    104786904
Enzymes [BR:csat01000]
 1. Oxidoreductases
  1.15  Acting on superoxide as acceptor
   1.15.1  Acting on superoxide as acceptor (only sub-subclass identified to date)
    1.15.1.1  superoxide dismutase
     104786904
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Sod_Cu
Motif
Other DBs
NCBI-GeneID: 104786904
NCBI-ProteinID: XP_010510677
LinkDB All DBs
Position
5
AA seq 216 aa AA seqDB search
MAANTILAFSSPSRLLIPHSSNPSSSLRSSFRGASLNNNLNRRPQSVSFSARAPSKALTV
VSAAKKAVAVLKGTSDVEGVVTLTQDDSGPTTVNVRITGLTPGPHGFHLHEFGDTTNGCI
STGPHFNPNKMTHGAPEDECRHAGDLGNIIANADGVAETTIVDNQIPLTGPNCVVGRAFV
VHELKDDLGKGGHELSLTTGNAGGRLACGVIGLTPL
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggctgccaacaccatcctcgcattctcatctccttctcgtcttctcattcctcactca
tccaacccttcttcaagtcttcgttcctctttccgcggtgcctctcttaacaacaacctt
aaccgtcgtccccaatccgtttccttctccgccagagctccttcgaaagcgttgacagtt
gtttccgccgcgaagaaggctgttgcagtgcttaagggtacctccgatgtcgaaggagtt
gttactcttacccaagatgactcaggtcctacaactgtgaatgttcgtatcactggtctc
actccagggcctcatggatttcacctccatgagtttggtgatacaacaaatggttgcatc
tcaacaggaccacatttcaaccctaataaaatgacacacggagctcctgaagacgagtgc
cgtcatgcgggtgacctgggaaacataattgccaatgccgatggtgtggcagaaacaaca
atcgtggacaatcagattcctctgactggtcctaattgtgttgttggaagagccttcgtg
gttcacgagcttaaggatgaccttggaaagggtggacatgagcttagtctgaccacagga
aacgcaggcggtagattggcatgcggtgtgattggcttgacgccgctctaa

DBGET integrated database retrieval system