KEGG   Camelina sativa (false flax): 26971514Help
Entry
26971514          CDS       T05044                                 

Gene name
rbcL, AZ282_gp056
Definition
(RefSeq) ribulose-1,5-bisphosphate carboxylase/oxygenase large subunit
  KO
K01601  ribulose-bisphosphate carboxylase large chain [EC:4.1.1.39]
Organism
csat  Camelina sativa (false flax)
Pathway
csat00630  Glyoxylate and dicarboxylate metabolism
csat00710  Carbon fixation in photosynthetic organisms
csat01100  Metabolic pathways
csat01200  Carbon metabolism
Module
csat_M00165  Reductive pentose phosphate cycle (Calvin cycle)
csat_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
csat_M00532  Photorespiration
csat_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:csat00001]
 Metabolism
  Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    26971514 (rbcL)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    26971514 (rbcL)
Enzymes [BR:csat01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.39  ribulose-bisphosphate carboxylase
     26971514 (rbcL)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: RuBisCO_large RuBisCO_large_N
Motif
Other DBs
NCBI-GeneID: 26971514
NCBI-ProteinID: YP_009231083
UniProt: A0A0U5JA86
LinkDB All DBs
Position
CP
AA seq 479 aa AA seqDB search
MSPQTETKASVGFKAGVKEYKLTYYTPEYETKDTDILAAFRVTPQPGVPPEEAGAAVAAE
SSTGTWTTVWTDGLTSLDRYKGRCYHIEPVPGEETQFIAYVAYPLDLFEEGSVTNMFTSI
VGNVFGFKALAALRLEDLRIPPAYTKTFQGPPHGIQVERDKLNKYGRPLLGCTIKPKLGL
SAKNYGRAVYECLRGGLDFTKDDENVNSQPFMRWRDRFLFCAEAIYKSQAETGEIKGHYL
NATAGTCEEMIKRAVFARELGVPIVMHDYLTGGFTANTSLAHYCRDNGLLLHIHRAMHAV
IDRQKNHGMHFRVLAKALRLSGGDHVHAGTVVGKLEGDRESTLGFVDLLRDDYVEKDRSR
GIFFTQDWVSLPGVLPVASGGIHVWHMPALTEIFGDDSVLQFGGGTLGHPWGNAPGAVAN
RVALEACVQARNEGRDLAVEGNEIVREACKWSPELAAACEVWKEIRFNFPTVDKLDGQE
NT seq 1440 nt NT seq  +upstreamnt  +downstreamnt
atgtcaccacaaacagagactaaagcaagtgttggattcaaagctggtgttaaagagtat
aaattgacttattatactcctgaatatgaaaccaaggatactgatatcttggcagcattc
cgagtaactcctcaacccggagttccacctgaagaagcaggggctgcggtagctgcggaa
tcttctactggtacatggacaactgtgtggaccgatgggcttaccagccttgatcgttac
aaaggacgatgctaccacatcgagcccgttccaggagaagaaactcaatttattgcgtat
gtagcttacccattagacctttttgaagaaggttcggttactaacatgtttacctcgatt
gtaggtaatgtatttgggttcaaagccctggctgctctacgtctagaggatctgcgaatc
cctcctgcttatactaaaactttccaaggaccacctcatggtatccaagtcgaaagagat
aaattgaacaagtatggacgtcccctattaggatgtactattaaaccaaaattggggtta
tccgcgaagaactatggtagagcagtttatgaatgtctacgtggtggacttgattttacc
aaagatgatgagaatgtgaactcccaaccatttatgcgttggagagaccgtttcttattt
tgtgccgaagcgatttataaatcacaggctgaaacaggtgaaatcaaagggcattatttg
aatgctactgcgggtacatgtgaagaaatgatcaaaagagctgtatttgccagagaattg
ggagttcctatcgtaatgcatgactacttaacagggggattcaccgcaaatactagtttg
gctcattattgccgagataatggcctacttcttcacatccaccgtgcaatgcacgctgtt
attgatagacagaagaatcatggtatgcacttccgtgtactagctaaagctttacgtcta
tctggtggagatcatgttcacgcgggtacagtagtaggtaaacttgaaggagacagggag
tcaactttgggctttgttgatttactgcgcgatgattatgttgaaaaagatcgaagccgc
ggtatctttttcactcaagattgggtctcactacctggtgttctgcctgtggcttcaggg
ggtattcacgtttggcatatgcctgctttgaccgagatctttggagatgattctgtacta
caattcggtggaggaactttaggccacccttggggaaatgcaccgggtgccgtagctaac
cgagtagctctggaagcatgtgtacaagctcgtaatgagggacgtgatcttgcagtcgag
ggtaatgaaattgtccgtgaagcttgcaaatggagtcctgaactagctgctgcttgtgaa
gtatggaaagagatcagatttaacttcccaaccgtcgataaattagatggccaagagtag

DBGET integrated database retrieval system