KEGG   Clostridium saccharobutylicum: CLSA_c15060Help
Entry
CLSA_c15060       CDS       T02876                                 

Gene name
abgA
Definition
(GenBank) 6-phospho-beta-glucosidase AbgA
  KO
K01223  6-phospho-beta-glucosidase [EC:3.2.1.86]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00010  Glycolysis / Gluconeogenesis
csb00500  Starch and sucrose metabolism
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLSA_c15060 (abgA)
   00500 Starch and sucrose metabolism
    CLSA_c15060 (abgA)
Enzymes [BR:csb01000]
 3. Hydrolases
  3.2  Glycosylases
   3.2.1  Glycosidases, i.e. enzymes that hydrolyse O- and S-glycosyl compounds
    3.2.1.86  6-phospho-beta-glucosidase
     CLSA_c15060 (abgA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Glyco_hydro_1 Cellulase
Motif
Other DBs
NCBI-ProteinID: AGX42506
UniProt: U5MS86
LinkDB All DBs
Position
1694295..1695710
Genome map
AA seq 471 aa AA seqDB search
MSIRFPEGFLWGGATAANQFEGAYNEDGKGLSTQDIAPKGVMGPLTDEPTEDNMKLIGID
FYHRYKEDIKLFAEMGFKVFRLSIAWSRIFPNGDDKEPNEKGLQFYDNVFDELAKYAIEP
LVTISHYETPLALAKNYDGWVNRKVIGFFENYVRTIFTRYKDKVKYWLTFNEINSATHFP
YMSAGIWTPKEKLSKQDLYQAMHHELVASALAVKIGHEINPKFKIGCMILGVPNYPLTPK
PSDVLKAMESDRQNLFFGDVHARGEYPRYMNRFFKENNIEIKMEPDDKEILKNTVDFVSF
SYYMSSCATADPEKDLKGKGNLIGGVANPYLKASDWGWQIDPEGLRYILNQFYDRYQKPL
FIVENGLGAVDELITDEHGNKTVNDDYRINYLNDHLVQVAEAIEDGVELMGYTTWGCIDL
VSASTAELKKRYGFIYVDRHDDGSGTLERYKKKSFNWYKEVIATNGASLKK
NT seq 1416 nt NT seq  +upstreamnt  +downstreamnt
atgtcaattagatttccagaaggatttttatggggaggagctacagctgctaaccaattt
gaaggtgcatataatgaagatggtaaaggattatcaactcaagatatagctccaaaagga
gttatggggcctttaactgatgagccaacagaagataatatgaagcttataggtattgat
ttttatcatagatataaagaagatattaaactttttgcagaaatgggatttaaagttttt
agattatcaattgcttggtcaagaatattcccaaatggtgatgacaaagagccaaatgag
aaggggttacaattttatgataatgtgtttgatgaattagctaagtatgcaatagaacca
ttagttacaatttcgcactatgaaactccacttgcgctagctaagaattatgatggatgg
gttaatagaaaggttataggattttttgaaaactatgtaagaacaatatttactagatat
aaagataaagtaaaatattggttaacttttaatgaaataaactcagcaactcattttcct
tatatgagtgcaggtatatggactccaaaggaaaaattaagtaagcaggatttatatcaa
gctatgcatcatgaattagttgcaagtgcattagctgtaaaaattggtcatgagataaat
ccaaaatttaaaattggatgtatgattcttggagtgccaaactatcctttaacaccaaaa
ccaagcgatgtacttaaagctatggaatcagacagacaaaatcttttctttggtgatgtt
cacgcaagaggagaatatccaagatatatgaatagattctttaaggaaaataatatagaa
ataaaaatggagcctgatgataaagaaatattaaaaaatacagtagattttgtgtcattt
agctattatatgagttcatgtgcaactgcagatccagaaaaagatttaaagggaaaagga
aatcttattggtggagttgcaaatccatatttaaaagcttcagactggggatggcaaata
gatccggaaggtctaagatatatattaaatcaattctatgatagatatcaaaaaccatta
tttattgttgaaaatggtttaggagctgttgatgaattaataactgatgaacatgggaat
aaaactgtaaatgatgattatagaattaactatttaaatgatcatttagttcaagtagca
gaagctatagaagatggcgttgaacttatgggatatactacatggggatgcatagactta
gttagtgcatcaactgctgaacttaaaaagagatatggttttatatatgtagatagacat
gatgatggaagtggaactttagaaagatataagaaaaagagttttaattggtacaaagaa
gttattgctacaaatggagcaagcttaaaaaaataa

DBGET integrated database retrieval system