KEGG   Clostridium saccharobutylicum: CLSA_c27470Help
Entry
CLSA_c27470       CDS       T02876                                 

Gene name
hslO
Definition
(GenBank) 33 kDa chaperonin
  KO
K04083  molecular chaperone Hsp33
Organism
csb  Clostridium saccharobutylicum
Brite
KEGG Orthology (KO) [BR:csb00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:csb03110]
    CLSA_c27470 (hslO)
Chaperones and folding catalysts [BR:csb03110]
 Heat shock proteins
  HSP33
   CLSA_c27470 (hslO)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: AGX43717
UniProt: U5MW86
LinkDB All DBs
Position
complement(3070686..3071564)
Genome map
AA seq 292 aa AA seqDB search
MEDKIIKATAKDGMVRIIAGITTNLVNEGTKIHDCTPVASDAFGRMLTAGTLIGTTLKSN
KEVTTLKINGNGEINGITVTAHSDGTVKGVIGNQYIDRPLNEKGKLDVGGAVGTNGMLYV
IKDLGLKDPYVGQVKIQTGEIAEDFAYYFTVSEQTPSAVSLGVLVDRDLSIKAAGGFIVQ
MLPGADELLADVITYRLQEIPPITTMINEGKTIEQILEYIFEGMDLKVLDSIKPEYKCDC
SRERVEKALISIGKDDLQEIYNDGKTEEIVCNFCNKKYEFTNEDIGQILKNK
NT seq 879 nt NT seq  +upstreamnt  +downstreamnt
atggaagataaaattattaaagctacagctaaagatggaatggttaggataattgcggga
ataacaactaacttagtaaatgagggaactaaaatacatgattgtacaccagttgcaagt
gatgcttttggaagaatgctaacagcaggaactttaattggaacaactttaaagagcaac
aaagaagtaactactttaaaaataaatggaaatggagaaattaatggtataactgtaaca
gctcatagtgatgggacagttaaaggagttataggcaatcaatatattgatagacctctt
aatgaaaaaggaaaattagatgtaggtggcgctgttggaacgaatggaatgttatacgta
ataaaagatttaggattaaaagacccttacgtaggtcaagttaagatacaaacaggagaa
attgcggaagactttgcatattattttacagtatcagaacaaactccatcagcagtatcg
cttggagtattagtagatagagacttatcaataaaagcagcaggtggatttatagtacag
atgttaccaggagctgatgagttacttgcagatgtaataacttatagattgcaagaaata
ccaccaataactactatgataaacgaaggaaaaacaatagagcaaatattagagtatata
ttcgaaggaatggacttgaaagttttggattctattaagcctgaatataaatgtgattgc
tcaagagaaagagtggaaaaagcattaatttcaattggaaaagatgatcttcaagaaata
tataatgatggaaaaacagaagaaatagtatgtaatttctgtaataaaaaatatgaattc
actaatgaagacattggtcaaatactaaaaaataaataa

DBGET integrated database retrieval system