KEGG   Clostridium saccharobutylicum: CLSA_c40500Help
Entry
CLSA_c40500       CDS       T02876                                 

Gene name
ddl
Definition
(GenBank) D-alanine--D-alanine ligase Ddl
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00473  D-Alanine metabolism
csb00550  Peptidoglycan biosynthesis
csb01100  Metabolic pathways
csb01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    CLSA_c40500 (ddl)
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    CLSA_c40500 (ddl)
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    CLSA_c40500 (ddl)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csb01011]
    CLSA_c40500 (ddl)
Enzymes [BR:csb01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     CLSA_c40500 (ddl)
Peptidoglycan biosynthesis and degradation proteins [BR:csb01011]
 Precursor biosynthesis
  Amino acid ligase
   CLSA_c40500 (ddl)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N RimK ATP-grasp_3 CPSase_L_D2 ATP-grasp GARS_A ATP-grasp_4 ATPgrasp_TupA ATPgrasp_ST TTL ATPgrasp_YheCD
Motif
Other DBs
NCBI-ProteinID: AGX45010
UniProt: U5MWP5
LinkDB All DBs
Position
complement(4483173..4484078)
Genome map
AA seq 301 aa AA seqDB search
MKVGVIMGGISSEREISLKSGNSILENINKEKYEIVPIVIDKKEDIVNKVNGIDFALLAL
HGQFGEDGTVQAVLQTLGIPYSGCGPLSSGMCMDKDVTKSILQAANIRTAPWINLNKDDE
INFDQINNLGYPVVVKPTHGGSSVATFVVKEEKDIKNCIEEAFKWDNEVMIEKFIKGDEI
TCPVYGDKMLPVIAIKPKSEFFDFASKYEDGGAEEIVVELEKNLHVEVEKMALATYRALK
CQVYSRVDMIVTQEGIPYILEVNTLPGMTKNSLIPKSAAAINIGFAELIDMIIEDSMKIE
R
NT seq 906 nt NT seq  +upstreamnt  +downstreamnt
atgaaagtcggagttataatgggcggtatttcatcagaaagagaaatatcattaaaaagt
gggaattcaatattagagaatataaataaggaaaaatatgaaatagtacctatagttata
gataaaaaagaagatatagtcaataaagttaatggcatagattttgcacttttggcattg
catggacaatttggagaagatggtacggtgcaagcagttcttcaaacattagggattcca
tattcaggatgtggtccattaagtagtggaatgtgcatggataaggatgtaacaaaatct
attttacaagctgctaacattagaactgcaccttggataaatctaaacaaagatgatgaa
attaattttgatcaaataaataacttaggatatccagtagtagttaagccaactcatgga
ggatcaagtgtagctacatttgttgtaaaagaagaaaaagatattaaaaattgtattgaa
gaagcatttaaatgggataatgaagttatgatagaaaagttcataaaaggtgatgaaata
acttgccctgtttatggagataaaatgcttccagttattgcaataaagccgaagtcagaa
ttctttgattttgcttcaaaatatgaagatggtggagcggaagaaatagttgtagagtta
gagaaaaatctacacgtagaagttgaaaaaatggcattagcaacatatagagcgctaaag
tgtcaagtatattctagagttgatatgattgttacacaagaaggtattccttatatttta
gaagtgaatacattaccaggaatgactaaaaatagcttgattcctaaaagtgcagcagca
ataaatataggatttgctgaattaatagacatgatcatagaagattcaatgaaaatagaa
agatag

DBGET integrated database retrieval system