KEGG   Clostridium saccharobutylicum: CLSA_c42910Help
Entry
CLSA_c42910       CDS       T02876                                 

Gene name
pfkA
Definition
(GenBank) 6-phosphofructokinase PfkA
  KO
K00850  6-phosphofructokinase 1 [EC:2.7.1.11]
Organism
csb  Clostridium saccharobutylicum
Pathway
csb00010  Glycolysis / Gluconeogenesis
csb00030  Pentose phosphate pathway
csb00051  Fructose and mannose metabolism
csb00052  Galactose metabolism
csb00680  Methane metabolism
csb01100  Metabolic pathways
csb01110  Biosynthesis of secondary metabolites
csb01120  Microbial metabolism in diverse environments
csb01130  Biosynthesis of antibiotics
csb01200  Carbon metabolism
csb01230  Biosynthesis of amino acids
csb03018  RNA degradation
Module
csb_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
Brite
KEGG Orthology (KO) [BR:csb00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    CLSA_c42910 (pfkA)
   00030 Pentose phosphate pathway
    CLSA_c42910 (pfkA)
   00051 Fructose and mannose metabolism
    CLSA_c42910 (pfkA)
   00052 Galactose metabolism
    CLSA_c42910 (pfkA)
  09102 Energy metabolism
   00680 Methane metabolism
    CLSA_c42910 (pfkA)
 09120 Genetic Information Processing
  09123 Folding, sorting and degradation
   03018 RNA degradation
    CLSA_c42910 (pfkA)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01009 Protein phosphatase and associated proteins [BR:csb01009]
    CLSA_c42910 (pfkA)
  09182 Protein families: genetic information processing
   03019 Messenger RNA Biogenesis [BR:csb03019]
    CLSA_c42910 (pfkA)
Enzymes [BR:csb01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.11  6-phosphofructokinase
     CLSA_c42910 (pfkA)
Protein phosphatases and associated proteins [BR:csb01009]
 Protein Ser/ Thr phosphatases
  Phosphoprotein phosphatases (PPPs)
   Protein phosphatase-1
    PP1-interacting proteins (PIPs)
     CLSA_c42910 (pfkA)
Messenger RNA biogenesis [BR:csb03019]
 Prokaryotic Type
  Bacterial mRNA degradation factors
   RNA degradosome components
    Other RNA degradosome components
     CLSA_c42910 (pfkA)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: PFK DAGK_cat
Motif
Other DBs
NCBI-ProteinID: AGX45251
UniProt: U5MZZ6
LinkDB All DBs
Position
complement(4815886..4816845)
Genome map
AA seq 319 aa AA seqDB search
MKKIAVLTSGGDAPGMNAAIRAVVRTALKNGIEVMGVQRGYSGLINGELFNMDKTSVSDI
IQRGGTILRTARCPEFKNEEVRKRAAKILQAYGVEALVVIGGDGSFTGAKLLSKLGIKTI
GLPGTIDNDLAYTDFTLGFDTALNTVVDAINKIRDTSTSHERVSIVEVMGRNCGDLSLYA
GIAGGAESIIVPEIDNFDKDQLCRTILDGKNHGKMHNLIILAEGIGGAFELAKYVEEITG
IETRATVLGHIQRGGSPSATDRVLASRMGAKAIDVLLEGKTSRVIGIKDNKIIDQDIDEA
LDMESKFDEELYKIAQILA
NT seq 960 nt NT seq  +upstreamnt  +downstreamnt
atgaaaaaaatagctgtattaacaagtggtggagatgcaccaggaatgaatgctgcaatt
agagcagtagtaagaactgcactaaaaaatggcattgaggtaatgggtgtacaaagagga
tatagtggattgatcaatggagaattattcaatatggataaaacttctgtatcagatata
attcaaagaggtggaacaattctaagaacagctagatgtcctgaattcaaaaacgaagaa
gtaagaaaaagagctgctaaaatcttacaagcttatggagttgaagctttagtagttata
ggtggagatggatcatttacaggagccaaactattatcaaaacttggaattaagactatt
ggattaccaggaacaattgataatgacttagcttatactgattttactttaggatttgat
acagcgttaaatactgttgttgatgctataaataaaattagagatacttctacttcacat
gaaagagtttcaatagttgaagttatgggaagaaattgtggagatttatctttatatgct
ggtatagcaggtggagcagaatcaattatagtacctgaaatagataacttcgataaagat
caactttgtagaactattttagatggtaagaatcatggaaaaatgcataacttaataata
cttgcagaaggtattggaggagcatttgaacttgcaaaatacgttgaagaaataacagga
attgaaacaagagcaactgttttaggacatattcaaagaggtggaagtccaagtgctaca
gatagagttttagcttcaagaatgggagcaaaggctatagatgtattattagaaggaaaa
acttcaagagttataggaattaaagataacaaaattattgatcaagatatagatgaagca
ttggatatggaaagcaaattcgatgaagaattatataagattgctcaaatattagcataa

DBGET integrated database retrieval system