KEGG   Caldicellulosiruptor saccharolyticus: Csac_0763Help
Entry
Csac_0763         CDS       T00506                                 

Definition
(GenBank) Alcohol dehydrogenase GroES domain protein
Organism
csc  Caldicellulosiruptor saccharolyticus
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ADH_N ADH_zinc_N Glu_dehyd_C ADH_zinc_N_2 ADH_N_2 Acylphosphatase UDPG_MGDP_dh_N ADH_N_assoc PglD_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-ProteinID: ABP66382
UniProt: A4XHJ7
LinkDB All DBs
Position
860311..861285
Genome map
AA seq 324 aa AA seqDB search
MRAAVFYGKRDLRVEEFDLPPLKQGEILVKVKACGICGTDVHIFNGEKGSAKVTPPIILG
HEFCGEVVETKSSLFKVGDKVSIDPNIYCGVCRFCRSGKVQLCESLTALGVNLNGGFAEY
AIVPEKQAILFEDIEFEEAALAEPLACCLHGIKKLEIKPIDKVLIIGLGPIGLIMLEILK
LYGAYNVYGYEIDEFRKEIAKWQGIKGIIEENTDEKFDIVIECAGTKESIEMAFEKLQKG
GQLLVFSVPSPKTNVLINPFEMFKKEARVYWSFVNPFTQKLAIELLRAKKISLKHIITHK
ISLEELSQALNNRYERQLKVIVQP
NT seq 975 nt NT seq  +upstreamnt  +downstreamnt
gtgagagcggcggtattttatggcaaaagagatttgagagtagaagaatttgatttgccc
ccgttaaaacaaggcgaaattttggtaaaggtcaaggcgtgtggaatatgtggaacagat
gtgcacatatttaatggcgaaaaaggttcagcaaaggtcacaccaccgattattttaggg
catgagttttgtggtgaggtagttgaaacaaaaagctcactttttaaagtaggggacaaa
gtaagtattgacccgaacatttattgtggggtatgtagattttgcagaagtgggaaagta
caattgtgcgaaagtcttacagctttgggtgtaaatttaaacggtgggtttgcagagtat
gcgattgtacctgaaaagcaagcaatattgtttgaagatatagaatttgaggaagcagca
ttggcagaacctcttgcttgctgtctccatgggattaaaaagcttgaaataaaaccaata
gataaggttttgataattggccttgggccaattggccttattatgcttgagattttgaaa
ctttatggggcttacaatgtctatggatatgagatagatgagtttagaaaagagattgcc
aaatggcagggtataaagggaataattgaggaaaatacagatgaaaagtttgacattgta
attgagtgtgcaggaacaaaagagagtattgagatggcatttgaaaagcttcaaaaaggt
ggacaactacttgtattttctgtgccctcaccaaagacaaatgttttaataaatcccttt
gagatgtttaagaaagaggcaagagtttattggtcatttgtaaacccgtttactcaaaaa
ttggcaattgaattacttagagcaaagaaaattagcttaaaacatataataacccacaaa
atttcattagaagagctttctcaagctcttaacaacaggtatgagagacagcttaaagtg
attgttcagccttga

DBGET integrated database retrieval system