KEGG   Caldicellulosiruptor saccharolyticus: Csac_0910Help
Entry
Csac_0910         CDS       T00506                                 

Definition
(GenBank) glutamyl-tRNA(Gln) amidotransferase, B subunit
  KO
K02434  aspartyl-tRNA(Asn)/glutamyl-tRNA(Gln) amidotransferase subunit B [EC:6.3.5.6 6.3.5.7]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00970  Aminoacyl-tRNA biosynthesis
csc01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csc00001]
 09120 Genetic Information Processing
  09122 Translation
   00970 Aminoacyl-tRNA biosynthesis
    Csac_0910
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03029 Mitochondrial biogenesis [BR:csc03029]
    Csac_0910
Enzymes [BR:csc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.5  Carbon-nitrogen ligases with glutamine as amido-N-donor
    6.3.5.6  asparaginyl-tRNA synthase (glutamine-hydrolysing)
     Csac_0910
    6.3.5.7  glutaminyl-tRNA synthase (glutamine-hydrolysing)
     Csac_0910
Mitochondrial biogenesis [BR:csc03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Other mitochondrial DNA transcription and translation factors
    Csac_0910
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GatB_N GatB_Yqey YqeY
Motif
Other DBs
NCBI-ProteinID: ABP66524
UniProt: A4XHY9
LinkDB All DBs
Position
1026396..1027838
Genome map
AA seq 480 aa AA seqDB search
MEYEVVIGLEVHAELATKSKIFCSCTTEFGGEPNTHCCPICTGMPGVLPVLNKKAVEYAI
MAGLATNCQIARYSKQDRKNYFYPDLPKAYQISQYDLPLCYNGYIDIEVNGQKKRIGIKR
IHIEEDAGKLLHDQWEEGSLVDFNRCGVPLIEIVTEPDLRSSEETRIFLEKLKAILQYTG
VSDCKMQEGSLRVDVNLSVRPKGSKEFGTRTEMKNLNSFRSVVRAIEYEAKRQIEVLESG
GVVVQETRRWDEAKGITLSMRTKEEAHDYRYFPEPDLPPIIVDDNWIEEIRKRIPELPDQ
KKERYIKEYGLPEYDAGVLTSSNAIANYFEECIKYTQNIKAASNWMMGEIMRILNDRGLE
PEEIVNIKIRPNQLASLINLVDNKTISNTIAKQVFEEMFETGKDPEVIVKEKGLVQITDR
NVILEAVKQAIANNPKSVEDYKNGKDKAFGFLVGQVMKITKGKANPQLVNEILREELEKI
NT seq 1443 nt NT seq  +upstreamnt  +downstreamnt
atggaatatgaggttgtgataggtttagaagtacatgcagagcttgcaacaaagtcaaag
attttttgcagctgcacaacagagtttggcggtgagccaaatacccactgctgtcctatt
tgcactggcatgccaggggtacttcctgttttgaacaaaaaggcggttgaatatgccata
atggcagggcttgcaactaactgccaaatagcaagatatagcaagcaggacagaaaaaat
tatttttatcccgaccttccaaaagcttaccagatttcacagtatgacttgccactctgt
tacaatggttatatagacattgaggtaaatgggcagaaaaagagaataggaataaagaga
attcacattgaagaggatgcaggtaaacttcttcatgaccagtgggaggaaggcagtctt
gttgactttaacagatgtggtgtacctttgattgagattgttacagaacctgatttacgt
tcaagtgaggagacacgaattttccttgaaaaactaaaggcaattttgcaatacacaggg
gtttctgactgcaagatgcaggaaggttcgctcagagtagatgtaaatctttctgtaagg
ccaaaaggttcaaaagagtttggaacaaggaccgagatgaaaaacttaaactcatttagg
tctgttgtcagggctatagaatatgaagcaaaaaggcaaatagaggttttggaaagtggc
ggtgttgttgtccaagagacaagaagatgggacgaggcaaaaggtataaccctttcaatg
aggacaaaagaagaagcacacgactatagatactttccagaacctgaccttccacctata
attgtagacgacaactggattgaggagatcagaaagagaattcctgagcttcctgaccag
aaaaaggaaaggtatataaaagagtatgggcttccagagtatgatgctggagttcttaca
tcatcaaatgcaatagcaaactattttgaagagtgcataaaatacacccaaaatataaag
gctgcaagcaactggatgatgggagagattatgaggatattaaatgacagaggattagag
cctgaggaaattgtcaacataaaaattaggccaaatcagcttgcaagcttgattaacctt
gttgataacaagacaatttccaatactattgcaaaacaagtctttgaagagatgttcgaa
actggcaaagatccagaggtcattgtaaaggagaaaggccttgttcagataacagacagg
aacgtaattttagaagctgtgaaacaggcaatagcaaacaatccaaaatcagtagaagat
tacaagaacggcaaagacaaggcgtttggatttttggtgggtcaagttatgaagataaca
aaaggcaaggcaaatccacagcttgtaaatgaaatcttaagagaggagcttgagaaaatt
tag

DBGET integrated database retrieval system