KEGG   Caldicellulosiruptor saccharolyticus: Csac_1372Help
Entry
Csac_1372         CDS       T00506                                 

Definition
(GenBank) D-alanine--D-alanine ligase
  KO
K01921  D-alanine-D-alanine ligase [EC:6.3.2.4]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00473  D-Alanine metabolism
csc00550  Peptidoglycan biosynthesis
csc01100  Metabolic pathways
csc01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csc00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Csac_1372
  09107 Glycan biosynthesis and metabolism
   00550 Peptidoglycan biosynthesis
    Csac_1372
 09160 Human Diseases
  09175 Drug resistance: antimicrobial
   01502 Vancomycin resistance
    Csac_1372
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csc01011]
    Csac_1372
Enzymes [BR:csc01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.2  Acid-D-amino-acid ligases (peptide synthases)
    6.3.2.4  D-alanine---D-alanine ligase
     Csac_1372
Peptidoglycan biosynthesis and degradation proteins [BR:csc01011]
 Precursor biosynthesis
  Amino acid ligase
   Csac_1372
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Dala_Dala_lig_C Dala_Dala_lig_N CPSase_L_D2 RimK ATP-grasp ATPgrasp_ST ATP-grasp_4 ATP-grasp_3
Motif
Other DBs
NCBI-ProteinID: ABP66974
UniProt: A4XJ89
LinkDB All DBs
Position
1543671..1544765
Genome map
AA seq 364 aa AA seqDB search
MTKLKVAVLFGGVSTEHEVSIVSAKSVMQNLDKEKYEIIPIGITKEGKWLLYTGKIEDLD
SKWTMYSIECFISPDRTKKALVKIKDSEATFIDIDVVFPVLHGLNGEDGTVQGLLELSGI
PYVGCGVLSSALCMDKAFAKKLALLEGIPQGHFLVIYKDEYLSKKEYFIRRIESEFSYPV
FVKPANSGSSVGISKAKDKDELILAIHEAFLYDTKILIEQAINAREIECAVLGNSEILVS
ALGEIVPSREFYSYEAKYIDGSSELIIPAKLEKQVEDEIKELAVKIYKLFECSGMARIDF
FVDKETNKVYFNEVNTIPGFTSISMYPKLMEYSGIPYPQLLDKLIQLAIEKNQQKQSIKY
SKEG
NT seq 1095 nt NT seq  +upstreamnt  +downstreamnt
atgaccaaattaaaggttgcagttttgttcggtggagtttcaacagagcatgaagtttcg
atagtatctgcaaaatcggttatgcaaaaccttgacaaggaaaaatacgaaataatacca
attggtattacaaaagagggaaaatggcttttgtacacaggcaagatagaagatttagac
agcaaatggacaatgtattcaattgaatgttttatctcaccagacaggactaaaaaagcg
cttgtgaagataaaagatagtgaagctacctttattgacattgacgttgtatttcctgta
ttgcatggattaaatggtgaggatggtactgtacaaggccttttagaactctctggtatt
ccatatgttgggtgtggagtgttgtcatcagcgctatgcatggacaaagctttcgccaaa
aaacttgctcttttagaggggattccacagggccactttttggtgatttacaaagatgag
tatctttccaaaaaagaatatttcatcagacggattgaaagtgagttttcgtatcctgta
tttgtaaagcctgcaaattcgggctcctcagttgggatttcaaaggcaaaagacaaagac
gagctgattttggcaatccacgaggcatttttgtatgataccaagattttgatcgaacag
gctataaatgcacgtgagattgagtgtgcagtgcttggcaatagcgaaattctcgtatcg
gccctgggtgagatagtaccatcgcgagagttttattcatatgaagccaagtatatagat
ggctcatcagaattgatcattcctgcgaaacttgaaaagcaggtagaggatgagattaag
gagcttgctgttaagatttacaagctttttgagtgtagtggtatggcaagaatagacttt
tttgttgacaaagaaactaacaaggtgtatttcaatgaagtaaatacaatccctggcttt
acaagtatttctatgtatccaaaattgatggagtacagcggtataccatatcctcaactt
cttgacaaactcatacaacttgcaattgaaaagaaccaacaaaaacaaagcataaaatat
agcaaagagggttaa

DBGET integrated database retrieval system