KEGG   Caldicellulosiruptor saccharolyticus: Csac_1460Help
Entry
Csac_1460         CDS       T00506                                 

Definition
(GenBank) pyruvate flavodoxin/ferredoxin oxidoreductase domain protein
  KO
K00169  pyruvate ferredoxin oxidoreductase alpha subunit [EC:1.2.7.1]
Organism
csc  Caldicellulosiruptor saccharolyticus
Pathway
csc00010  Glycolysis / Gluconeogenesis
csc00020  Citrate cycle (TCA cycle)
csc00620  Pyruvate metabolism
csc00633  Nitrotoluene degradation
csc00640  Propanoate metabolism
csc00650  Butanoate metabolism
csc00680  Methane metabolism
csc01100  Metabolic pathways
csc01110  Biosynthesis of secondary metabolites
csc01120  Microbial metabolism in diverse environments
csc01130  Biosynthesis of antibiotics
csc01200  Carbon metabolism
Module
csc_M00307  Pyruvate oxidation, pyruvate => acetyl-CoA
Brite
KEGG Orthology (KO) [BR:csc00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    Csac_1460
   00020 Citrate cycle (TCA cycle)
    Csac_1460
   00620 Pyruvate metabolism
    Csac_1460
   00640 Propanoate metabolism
    Csac_1460
   00650 Butanoate metabolism
    Csac_1460
  09102 Energy metabolism
   00680 Methane metabolism
    Csac_1460
  09111 Xenobiotics biodegradation and metabolism
   00633 Nitrotoluene degradation
    Csac_1460
Enzymes [BR:csc01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.7  With an iron-sulfur protein as acceptor
    1.2.7.1  pyruvate synthase
     Csac_1460
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: POR_N PFOR_II Transketolase_C
Motif
Other DBs
NCBI-ProteinID: ABP67060
UniProt: A4XJH5
LinkDB All DBs
Position
1621245..1622426
Genome map
AA seq 393 aa AA seqDB search
MAIRDRLSGNEAIAYAMRQINPDVVAAFPITPSTEVPQYFSQFVANGEVDTEFIAVESEH
SAMSACIGASAAGARTMTATSSQGLALMWEMLYIAASMRLPIVMAVINRALSGPINIHND
HSDSMGARDSGWIQIYCENNQEAYDSLIQAIRIAEHKDVRLPVMVCYDGFITSHAVENIE
LLEDEVVRNFIGEYNPEYYLLNEQNPISMGPLDLPPYYFEHKRQQAEAMRNAKKVVLEVA
DEFAKISGRKYGLFETYKLDDAEVAIVVMNSTAGTAKAVVDEYRSKGYKVGLLKPRLFRP
FPVEEIVNALKHLKAIAVMDKTDSFNAAGGPLFTEVTSALYGRADGIKVINYIYGLGGRD
VKTDDIAKIYDRLLDIVKTGNVGEVYNYIGVRE
NT seq 1182 nt NT seq  +upstreamnt  +downstreamnt
atggcaattcgtgatagacttagcggtaacgaggcaatagcgtatgctatgagacagata
aatcctgatgttgttgccgcgtttccaataacaccttcaactgaggtaccacagtatttt
tctcaatttgttgcaaatggtgaggttgacactgagtttattgctgttgaatctgaacac
agtgcgatgagtgcctgcattggtgcttcagcagcaggtgctcgaacaatgacagctaca
tcctcacaaggtttagctctgatgtgggagatgttatatattgctgcttcaatgagactt
ccaatagtaatggcagttataaatagagcactttctgggcctattaacattcacaacgac
cattcagactcaatgggtgcaagagacagtggatggattcagatttattgcgaaaacaat
caagaggcatatgactctttgattcaggcaatcaggattgcagagcacaaggatgtaaga
cttcctgttatggtatgttatgatggatttatcacaagccatgctgttgagaatatagaa
cttttagaggatgaggttgtcagaaacttcatcggtgagtacaatcctgaatattacctt
ttgaatgaacaaaatccaatttcaatgggtccgttagacttgccaccgtactactttgaa
cacaaaagacaacaagcagaggctatgagaaatgcaaagaaggtagttttagaggtagct
gatgagtttgcaaagataagtggaagaaagtatggactttttgagacgtacaagcttgat
gatgcagaggttgcaattgttgttatgaactcaacagcaggaacggctaaagctgtggtt
gacgagtacagaagcaaaggatacaaggtaggacttctaaaaccaagactattcagacca
ttcccagttgaggaaattgtaaatgcactaaagcacctaaaagcaattgctgtaatggac
aagacagacagctttaacgctgcaggtggtcctctatttacagaggttacaagtgctctt
tatggtagagcagatggcatcaaagttatcaactacatttatggtcttggtggaagagat
gttaaaaccgatgacattgctaagatatatgacagacttcttgacattgtcaaaacaggc
aatgttggagaagtttacaactacattggcgtgagagaataa

DBGET integrated database retrieval system