KEGG   Centruroides sculpturatus (bark scorpion): 111612850Help
Entry
111612850         CDS       T06064                                 

Definition
(RefSeq) sorbitol dehydrogenase-like
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00040  Pentose and glucuronate interconversions
cscu00051  Fructose and mannose metabolism
cscu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    111612850
   00051 Fructose and mannose metabolism
    111612850
Enzymes [BR:cscu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     111612850
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_N ADH_zinc_N ADH_zinc_N_2 Glu_dehyd_C AlaDh_PNT_C Methyltransf_25 TrkA_N 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 111612850
NCBI-ProteinID: XP_023209884
LinkDB All DBs
Position
Unknown
AA seq 352 aa AA seqDB search
MSSAADNLSLVLYPTKELKLENRPVPVPKDNEVLISIHCTGVCCTDIHLWSWGRVANINV
ETPTVIGHESSGTVVQVGKNVKKFKIGDRVVIDTSDPCLDCNRCLEGNYHLCASIKCLGL
PPVHGTYARYVTHPAVFCHKIPDNMSYEEGALIEPLSVTVHACRRGKVTGGDKILICGAG
TIGVLTMLTARSMGATKICVTDIRQDRLDFAKKLGADHVLLADPDSNICAQRVRELLGDF
PDVSLDCCGFEATLRVAMKATKPRGAVVVIGIGPGEAKLPIAETMYKEIDLIGVNRFPNC
YPRAIDLVASGAINVKPLITHRFKLEQAIEALKLLKEEKPGTVKVMIHCQKS
NT seq 1059 nt NT seq  +upstreamnt  +downstreamnt
atgtcttctgcagcagacaatttgtctttggttctttacccaacaaaagaattaaaattg
gaaaaccgtccagtaccagtaccaaaagataatgaagtattaatcagcatacattgtact
ggagtatgctgcacagacatacatctatggtcgtggggtagagtagctaatataaatgta
gaaacaccgactgttattgggcacgaatcgagtggaaccgtagttcaagtaggaaaaaat
gtcaaaaaatttaaaataggggatagagtggttattgatacgagcgatccctgtttggac
tgtaacagatgtttggagggcaattatcacttatgtgcaagcataaaatgcttaggatta
cctcctgttcacgggacatatgccagatatgtgactcatccagcagtattttgtcacaaa
ataccggataatatgtcttacgaagaaggtgcattaattgagcctttatctgtaacagtt
catgcatgtagaagaggtaaagtgacgggaggagataaaattttaatctgtggagctggt
actataggcgtactgactatgctaacagctcgctctatgggcgctacaaaaatatgtgta
acagatatacgtcaggataggttagattttgctaagaaattgggagcagatcacgttctc
ttggccgatcctgacagcaacatctgtgctcaacgagtaagagaattattgggagatttt
cctgatgtcagtttagattgctgtggctttgaagcaacgctgagagttgctatgaaggca
actaaacctagaggagccgtagtagtaatcggtataggtcctggagaagctaaacttccc
atagcagaaaccatgtataaggaaatcgatctgattggtgtcaatcgctttccaaactgc
tatcccagagctatagatttggtagccagcggcgcaattaatgttaaacctctaataact
catcgttttaaactggaacaggcgatagaagctttgaagttattgaaagaagaaaagcca
ggaaccgttaaagttatgatccattgccagaaaagttaa

DBGET integrated database retrieval system