KEGG   Centruroides sculpturatus (bark scorpion): 111619022
Entry
111619022         CDS       T06064                                 

Definition
(RefSeq) nitric oxide synthase, inducible-like
  KO
K13241  nitric-oxide synthase, inducible [EC:1.14.13.39]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00220  Arginine biosynthesis
cscu00330  Arginine and proline metabolism
cscu01100  Metabolic pathways
cscu04146  Peroxisome
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09105 Amino acid metabolism
   00220 Arginine biosynthesis
    111619022
   00330 Arginine and proline metabolism
    111619022
 09140 Cellular Processes
  09141 Transport and catabolism
   04146 Peroxisome
    111619022
Enzymes [BR:cscu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.13  With NADH or NADPH as one donor, and incorporation of one atom of oxygen into the other donor
    1.14.13.39  nitric-oxide synthase (NADPH)
     111619022
SSDB
Motif
Pfam: NO_synthase FAD_binding_1 Flavodoxin_1 NAD_binding_1
Other DBs
NCBI-GeneID: 111619022
NCBI-ProteinID: XP_023216425
LinkDB
Position
Unknown
AA seq 1066 aa
MKIEESNTKVEERRCPFSGVKIRNYLSGRENKDKLYERSKDIACQKNCCYGSFMSGLSGI
RSPTEKRSKREVLEDAKEFFQQYFESKKIDNEARELRIMNVKNAIESTGTYELSEEELLF
GAKMAWRNASRCIGRIQWNKLILQDARHVRSTKEMFEKLCEHLALGTNGGNIRSVITVFP
QRQLGRDDYRLWNPQLLSFAGYLQPDGSVIGDPGRVKFTRICQRLGWKGRGGKYDILPWV
LSSPDEGPQVYDIPEELVLRIHLEHPNYPWFKDLGYQWYAVPAVANMMLDCGGLMFTAAP
FNGWYMGTEIGARDLCDPQRYNITEEVGSRLGIDTSNTSTLWKDRVLLEVNLAVLYSFQK
NNVTIVDHHTASETFIKHFESEQKQRGGCPADWVWIVPPMSGSITSVFHQEMLCYSLKPS
YEYQEDAWLHYQWPKNNNVAPKYKFASISKVIFFAVIMNKITKSNREAITILYATETGKS
ETYAMRLEQILSNTFLVRNFCMQDYDLEQIVNESILIVISSTFGNGEPPDNGKEFWKKIN
RCEDLRSRANNQLKFSVFALGSTQYPTFCAFGKNIDSLLSKMGQRILPVELGDELRGQEQ
TFNKWTEILYKAIINLLGLKFDESQYFSVEDFAVWKPENYKLNVVSSQPNTNICQELSRL
HSKRVLPYKLLSCAKLQARHSSRQTVLVRFLPSSNDYLDYFPGDHIGVFASNSPKLVNDI
INKINTTRINPDAILDIQCFSGGKWSKASRLPPCSLRTAMTKFLDLTTPPTANLLLLMSS
LATEKWDVYRLKKLATDIDEYEEWKSAQYPNLADFLEEFNSVKLTPEFILTQLPLLQPRY
YSVSSSTLSHPYEILLTVAVLNFRSHDGKGKLHHGLCSNYLNSYPKDDIPIFVRSAPGFH
LPADVSLPIIMIGAGSGIAPFKSFWMHKEMEMKQMKIGKLFLFFGCRQRNLDLVYEHETS
PLVRKGVLSHVFNVFSREPNQKKKYVQDAVKDEAKLVYEMIQQNGHIYVCGDAAMSEGVR
KAVKYVLVYQGNYSKEEAENYFIQLQNDGRYHEDVFGVSYRGSSSL
NT seq 3201 nt   +upstreamnt  +downstreamnt
atgaaaatcgaagaaagtaacacgaaagtggaggaacgtcggtgtccattttctggcgtg
aagataaggaattacttatctggtagagaaaacaaagataaactttacgaacgatcgaaa
gatatagcgtgccaaaaaaattgctgttacggttcgtttatgtccggcctttctggtata
cgttctcctaccgagaagaggagtaagcgggaggttctcgaagatgctaaagaatttttt
caacagtattttgaatcgaaaaaaattgataacgaagctcgcgaattaagaattatgaat
gttaaaaacgccatcgagagtactggaacttatgagttgagcgaagaggaattgctgttt
ggtgctaaaatggcttggaggaatgcttcgcgttgtattggaaggattcaatggaataaa
ttaattttgcaagatgctagacacgttagatctactaaggagatgttcgagaaactatgc
gaacatctagcgcttggaactaatggtggcaacatcaggtcagttataacagtatttcca
caacgtcaattgggtagagacgattaccgattgtggaatccacaacttttaagttttgct
ggataccttcagccagatggaagcgttataggagatccgggacgtgtcaaattcactcga
atctgtcagaggttaggatggaagggacggggagggaagtatgatattttaccatgggtg
ttatcgtcacccgacgaaggaccacaggtttatgatattccagaagaattagtattgaga
attcatctagagcatccgaattatccatggtttaaagatttgggttatcaatggtacgct
gttccagcagttgctaacatgatgttagattgtggtggacttatgttcacagctgctcca
ttcaacggatggtacatgggtacagaaattggtgcaagagatttatgcgatcctcagcga
tataatattacagaggaagttggatctagactcggcattgacacgtcaaacaccagcacc
ctttggaaagatcgtgtattgttggaagtaaatttagctgttctctacagttttcagaaa
aataatgtaactattgttgatcatcataccgcttcagaaacttttatcaaacatttcgaa
tctgaacaaaagcagaggggtggttgtccagcagattgggtttggatagttccacccatg
agtggtagtattacttcagtttttcatcaagaaatgttatgttacagtcttaaacccagt
tacgagtatcaagaagatgcttggcttcattatcagtggcctaagaataacaacgttgca
ccgaagtataaattcgcatcaatatcaaaagttatatttttcgccgttataatgaataaa
atcactaaatccaacagagaagccattacaattttgtacgcaaccgaaacaggaaagtct
gaaacgtatgcgatgaggctggaacagatattatctaatacatttttagttagaaacttt
tgcatgcaagattatgacttggagcaaattgttaacgagtccattctgatcgttattagc
agtacttttggaaacggagaacctccagataatggaaaagaattttggaaaaaaattaat
cgatgcgaagatcttcgctccagagcaaataatcaattaaagttttcagtatttgcttta
ggatcgactcaatatccaacattttgtgcttttggcaagaatatagattcgcttctgagc
aaaatgggtcaaagaatacttcccgttgaattaggggatgaacttcgtggacaagaacag
acattcaacaaatggacagagattttatacaaggcaataattaatttattaggcttgaaa
tttgatgaaagtcaatacttctccgtagaagatttcgctgtatggaaaccggaaaattat
aaattaaatgtagtttctagtcaaccaaacacaaatatctgtcaagaactttcgcgctta
cactcgaaacgtgtccttccatataaattattatcttgtgcgaaattgcaagcgagacat
tccagtcgacagacagttttagttcgtttcttaccatcttcaaacgattatctcgactat
tttcctggtgatcatatcggtgtcttcgcatcgaattcgccgaaactcgtcaacgatatc
attaacaaaatcaacactacgagaataaatcctgatgccatcttagatattcaatgtttt
tctggtggtaaatggtcgaaagcgtcacgacttcctccttgctccctaagaacagccatg
acaaaatttttagacttgactacacctcctaccgctaatttattattgttaatgtcaagt
ttagctacagaaaaatgggatgtttatagattaaagaaacttgctacggatatagacgag
tacgaagaatggaaatctgcccaatatcctaacttagccgattttctcgaagaatttaat
tcagttaaattaactcccgagtttattttaactcaattaccgttgcttcaacctcgatac
tatagcgttagtagttctacgttgtctcatccttacgaaattttgttaactgttgccgtt
ctaaatttcagatctcacgatggaaagggcaagttgcaccacggactgtgttccaattat
ctgaacagttatccgaaagacgatataccaatttttgttcgaagtgctcccggctttcat
ctacccgcggatgtatcgttaccaattatcatgataggagcaggaagtggaatagcacca
tttaaaagcttttggatgcacaaggaaatggagatgaaacaaatgaaaatcggtaaatta
tttctattttttggatgtagacaacgtaacttggatctggtatacgaacacgaaacgtca
ccactcgttaggaaaggcgttctaagccacgtctttaacgtattctcgagagaaccaaac
cagaaaaagaaatacgttcaagatgcagttaaagacgaagctaaactggtatacgaaatg
atacagcagaatggtcacatatatgtttgtggcgatgctgcaatgagcgaaggtgtcaga
aaagctgtgaaatacgtactcgtttatcaaggaaattactcaaaagaagaagccgagaac
tattttattcaattacagaacgatggacgttatcacgaagacgtgtttggagtaagttac
agaggatcttcaagtttgtga

DBGET integrated database retrieval system