KEGG   Centruroides sculpturatus (bark scorpion): 111621814
Entry
111621814         CDS       T06064                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: adenylate cyclase type 3-like
  KO
K08043  adenylate cyclase 3 [EC:4.6.1.1]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00230  Purine metabolism
cscu01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    111621814
Enzymes [BR:cscu01000]
 4. Lyases
  4.6  Phosphorus-oxygen lyases
   4.6.1  Phosphorus-oxygen lyases (only sub-subclass identified to date)
    4.6.1.1  adenylate cyclase
     111621814
SSDB
Motif
Pfam: Guanylate_cyc AC_N HNOBA ApoO DUF1053
Other DBs
NCBI-GeneID: 111621814
NCBI-ProteinID: XP_023219829
LinkDB
Position
Unknown
AA seq 1405 aa
MVDKETTKEVIIALEDGKVECDEDCKRNLPKRSSSLLRRGDTTLSIDTTGFQRYLPSCIQ
FAFADQEVEQLYRQFCQNEKCSELKSFLIIVIVVDLTLLTLYGLSYQQQKLPQLIVLLVL
FVSLVILLILTWKWSIPRLLWTFIPYLMWLVQVGHVFCDVWLYPLPRLPVDAVSWIVLYT
YSLYILLPMQISLCVTLGVLMAFLHSLLIAILPEDHNHLGYQFGANVCLYVCTNLLGAMT
YFFMERQQRKAFLETRQSLEAKLILEEESQEQERLLLSVLPKHVAAEIRQDLGAVVTGQF
KKIYMCRHENVSILFADIVGFTAISSTCPAAELVRTLNELFARFDKLAEKYHQLRIKILG
DCYYCISGAPIDRSDHAVLCVHMGLSMVEAIRSVREQTKSTVDMRVGVHTGGVLAGVLGQ
RQWQFDVYSRDVELANKMESGGLPGRVHISEKTLSYLNGEFEVMPGDGASREEAIRLAGI
KTFFIVQVLKPVRRTFLINTTVENNTEEENVRKDVNEYHLRLHKELINTERQDLGKYVRL
FTLWFIDPKLEDQYQNSTDSTSCISMGGLLVILISHMAAYFFVMYGSLVVYVTFPCGLIV
ISSIFFLIIASLLSKSAPKLLSSFSQKIQESIWLRIGIAITLISTWFAVHLVSMIFSSVP
VSNNPNTTFIISKNSAAFPPYFSYFSILGVLGVTVVANISHMIKILFTVIIILVQCCFNI
LLQSSWLDWYDATFYPQKQLNIYHQESLSIILVGVSLCLIIINWQFEKTSRKLFLWQKEV
EEQREKVADMRRKNEALVYNILPPHVAKHFLGRNKKDEELYSKSYEAVGVLFAAMPNFSD
FYTEETVNNQGLECLRFLNEVISDYDALLEQPRFRDIIKIKTIGSTYMAASGLSEEETVK
QDAPIKEKWAHLSRLTEFALTLKATLNNINKESFNNFVLRMGPKLFLWQKEVEEQREKVA
DMRRKNEALVYNILPPHVAKHFLGRNKKDEELYSKSYEAVGVLFAAMPNFSDFYTEETVN
NQGLECLRFLNEVISDYDALLEQPRFRDIIKIKTIGSTYMAASGLSEEETVKQDAPIKEK
WAHLSRLTEFALTLKATLNNINKESFNNFVLRMGPYFFNYXFEKTSRKLFLWQKEVEEQR
EKVADMRRKNEALVYNILPPHVAKHFLGRNKKDEELYSKSYEAVGVLFAAMPNFSDFYTE
ETVNNQGLECLRFLNEVISDYDALLEQPRFRDIIKIKTIGSTYMAASGLSEEETVKQDAP
IKEKWAHLSRLTEFALTLKATLNNINKESFNNFVLRMGINQGPITAGVIGARKPHYDMWG
NTVNVASRMESTGKAGCIQVVEETSRILEEFGYVFEQRGLVTVKGKGKLMTYYLVGKKHE
NGVTYEDLRRSPSLIPNSAADPHCQ
NT seq 4218 nt   +upstreamnt  +downstreamnt
atggtggacaaggagactactaaggaagtgatcatagctttagaagacggaaaagtagaa
tgtgatgaggattgtaaacgtaatttacctaaacgttcttcttcgttgctcaggcgaggc
gataccactctcagcatcgacaccactggctttcaacgttatttgccctcctgtatacag
tttgcttttgcagatcaggaagtggaacagctctatcgtcagttctgtcagaacgagaaa
tgcagcgaactcaagtcattcctaataattgttattgtcgtcgacttgactttattaact
ttatacggcctttcttaccaacagcagaaacttcctcagttgatagttttacttgtcctc
ttcgtctcgctagtgatcttgttgatattaacgtggaaatggagcatacctcgacttctt
tggacttttataccgtatttaatgtggctagttcaagtcggccacgttttctgcgacgtt
tggctttatccgttacctcgtctcccagtcgatgccgttagttggattgttttatatact
tattctctctatatacttctacccatgcaaattagtctgtgtgtcacgttgggagtatta
atggcctttcttcattcgctactcatcgccatattaccggaagatcacaatcatctagga
tatcagttcggtgcaaatgtatgtctttacgtgtgtactaatcttctcggagctatgact
tacttcttcatggaacggcaacagaggaaagcttttctagaaactcgtcagagtctagaa
gctaaattaatcttagaagaggaatctcaggaacaggaaagactgctgttatcggttcta
ccgaaacacgtggctgcagaaatcagacaagacttgggagccgtggtaacgggacagttt
aaaaaaatttacatgtgcagacacgaaaatgtcagtattttatttgctgatattgttggt
ttcacagcaatatcttccacttgtcctgcagccgaacttgtaagaacattaaatgaatta
tttgcaagatttgacaaattagccgagaagtatcatcagctaagaataaagattttaggc
gattgttactactgcatcagtggtgctcccattgatagatcagatcatgcagtgctttgt
gtacatatgggacttagcatggtcgaggctatcagatccgtaagagaacaaacaaaatct
accgttgacatgagagttggagtgcatacaggaggagtgctggctggtgttttgggacag
agacaatggcagtttgacgtttacagcagagatgtggagttggctaacaagatggagagt
ggaggattaccaggtcgtgtacatatatctgaaaaaactctcagctatttaaatggtgaa
tttgaagttatgccaggcgatggtgcatcaagagaggaagcaattcgtcttgctggaata
aaaactttttttatagttcaagtgctgaagccagtaagacgtacttttttgataaatacc
acagtagaaaataatacagaagaggaaaatgttaggaaagacgtcaacgaatatcatttg
agacttcataaagagttaattaatacagaaagacaagacttaggcaaatatgtcagatta
tttactctttggtttattgatccgaaattggaagatcaatatcaaaacagcacagatagc
accagctgcatttcgatgggaggtttattggtcattcttatctcccatatggctgcttac
tttttcgttatgtatgggagccttgtcgtttatgtaacttttccgtgtggattgattgtc
atcagtagcattttcttccttataattgcatcgcttttgtcaaagtcggctccaaaatta
ttatcgtcgttttcacaaaaaattcaagaaagtatttggttaagaataggaattgcaata
acattaatatcaacgtggtttgccgtccatttggttagcatgatattttcttcggttccc
gtttccaataatccaaatactacttttataatttccaaaaatagtgcagcatttcctcct
tattttagttattttagcatactcggtgttctcggtgttaccgttgttgctaacatcagt
cacatgatcaaaattttatttacagtaattataatactcgttcagtgttgttttaatatc
ttgcttcagtcttcgtggctcgattggtacgacgccacgttctatcctcaaaaacaactg
aatatttatcatcaagagagtttatcaattattcttgttggagtctcgctgtgtcttata
ataattaattggcagtttgaaaaaacatctaggaagttatttctatggcaaaaagaagta
gaagaacaaagagagaaggtagcagatatgagaaggaagaacgaagcactagtttataat
atattaccacctcacgtcgctaaacatttcttaggaagaaataaaaaagacgaagaacta
tacagtaaaagttacgaagctgttggagtattatttgcagccatgccgaatttttcagac
ttttatacagaagagacggttaacaaccaaggattagaatgcctcaggtttctaaatgaa
gttatctcggattacgatgcgctcttagaacagccaagatttcgcgatattattaaaata
aaaacaatcggttcaacttacatggctgccagtggattgagtgaagaagaaactgttaaa
caagatgctccaattaaagagaagtgggctcatctgtctaggttaaccgaatttgcgctg
acattaaaagcaactctaaacaacatcaataaagaaagtttcaacaattttgtacttcga
atgggtccgaagttatttctatggcaaaaagaagtagaagaacaaagagagaaggtagca
gatatgagaaggaagaacgaagcactagtttataatatattaccacctcacgtcgctaaa
catttcttaggaagaaataaaaaagacgaagaactatacagtaaaagttacgaagctgtt
ggagtattatttgcagccatgccgaatttttcagacttttatacagaagagacggttaac
aaccaaggattagaatgcctcaggtttctaaatgaagttatctcggattacgatgcgctc
ttagaacagccaagatttcgcgatattattaaaataaaaacaatcggttcaacttacatg
gctgccagtggattgagtgaagaagaaactgttaaacaagatgctccaattaaagagaag
tgggctcatctgtctaggttaaccgaatttgcgctgacattaaaggcaactctaaacaac
atcaataaagaaagtttcaacaattttgtacttcgaatgggtccttatttctttaattat
tagtttgaaaaaacatctaggaagttatttctatggcaaaaagaagtagaagaacaaaga
gagaaggtagcagatatgagaaggaagaacgaagcactagtttataatatattaccacct
cacgtcgctaaacatttcttaggaagaaataaaaaagacgaagaactatacagtaaaagt
tacgaagctgttggagtattatttgcagccatgccgaatttttcagacttttatacagaa
gagacggttaacaaccaaggattagaatgcctcaggtttctaaatgaagttatctcggat
tacgatgcgctcttagaacagccaagatttcgcgatattattaaaataaaaacaatcggt
tcaacttacatggctgccagtggattgagtgaagaagaaactgttaaacaagatgctcca
attaaagagaagtgggctcatctgtctaggttaaccgaatttgcgctgacattaaaggca
actctaaacaacatcaataaagaaagtttcaacaattttgtacttcgaatgggtattaac
cagggcccaataactgctggagtgattggagcgagaaaaccacattacgatatgtgggga
aacacagttaacgttgctagtcgtatggaaagcacagggaaagccggttgtattcaggtt
gttgaagaaacatctcgtatattggaagaatttggctacgttttcgaacaacgtggactc
gtcactgttaaaggcaaagggaaattaatgacttattacttagttggcaaaaaacacgaa
aatggagtaacttacgaagatttacgcagatctccttctttaatacctaattctgcagcg
gatcctcattgccagtga

DBGET integrated database retrieval system