KEGG   Centruroides sculpturatus (bark scorpion): 111623758
Entry
111623758         CDS       T06064                                 

Definition
(RefSeq) ras association domain-containing protein 1-like isoform X1
  KO
K09850  Ras association domain-containing protein 1
Organism
cscu  Centruroides sculpturatus (bark scorpion)
SSDB
Motif
Pfam: RA Nore1-SARAH C1_1 RE_HindVP Thioredoxin_9 Ras_bdg_2 Mst1_SARAH BPS1
Other DBs
NCBI-GeneID: 111623758
NCBI-ProteinID: XP_023222222
LinkDB
Position
Unknown
AA seq 402 aa
MSNLALDHRNVRRIKIPSITPPAGRKNFGASPDDGRSKLGFSPTGIWQNFVLPLPFRRRS
KSKDSPSRQRNEGNMRPRELIELSSFGVVELEPIEHGIGHHFQPAQLRNPTWCDRCGDFV
WGLYRSEQCFRCINCYYTCHRQCLELVTLDCKGIGDIQTTDVDEILAPPTNSVTKDKEDK
SDITSLFADCFEEEELRQRINKYNDHVQNLEMTMQENGKVFNGFIRVCLNLTRPINVIAG
TRPPSIYDILKEEEESGRKTLTSFYLPRDTVKALHITSEYTTREVICALLKKFKVADNPH
KFALYEQYNDTETKKGKMRRIHDHEKPLVLALMWCGESKQFVLQENETEDIVWEAFALAE
LSNFLKILDREEEEYLNQVRNKYHILQKKLQEAIEKKKPLQC
NT seq 1209 nt   +upstreamnt  +downstreamnt
atgtctaatttagcacttgatcatagaaatgtgagaagaattaaaattccttcgataact
cctccagctggaaggaaaaattttggtgcatctccagatgacggtagatctaaactcggt
ttcagtcctactggaatttggcagaattttgtccttcctttgccatttcgtagaagatca
aagtctaaggattctccatctcgtcaacggaatgaaggtaatatgcgtcccagagaatta
attgaattatcaagttttggagttgtggaattagaaccaattgaacatggaattggtcat
catttccaaccagcccaattgagaaatccaacatggtgtgacagatgtggagattttgtt
tggggattatatagatcagagcaatgctttcgatgcattaactgctattatacatgtcat
cgtcaatgccttgaacttgttactttggactgcaaaggtattggagatattcaaacgaca
gatgttgatgaaattctagcaccaccaacaaattctgtgacaaaagataaagaagacaag
tctgatataacatcattatttgctgattgttttgaagaagaagaattaagacaacgaata
aataaatataatgatcatgttcagaatttggaaatgacgatgcaagaaaatgggaaagtt
tttaatggttttattcgtgtatgtttaaatttgacacgacctattaatgtaattgctggt
acacgtccaccgtcaatttatgatatcttgaaagaggaggaggaaagtggaagaaagaca
ttaacatctttttatttaccaagagatacagttaaagctttacacattaccagtgaatat
actactagagaagttatatgtgctcttcttaagaaattcaaagttgctgacaatcctcat
aaatttgccttatatgaacaatataatgatacagaaacaaaaaaaggtaaaatgagaaga
attcatgatcatgaaaaaccattagtgttagctctaatgtggtgtggtgaaagcaaacaa
tttgttcttcaagaaaatgaaacagaagatattgtttgggaggcatttgcattggcagaa
ttgagcaactttttgaaaatcttggatagagaagaagaagaatatttgaatcaagtacga
aataaatatcatatattacagaagaagttacaggaagcaatagaaaagaagaagccttta
cagtgttga

DBGET integrated database retrieval system