KEGG   Centruroides sculpturatus (bark scorpion): 111629548
Entry
111629548         CDS       T06064                                 

Definition
(RefSeq) uncharacterized protein LOC111629548
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu04068  FoxO signaling pathway
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    111629548
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 111629548
NCBI-ProteinID: XP_023229232
LinkDB
Position
Unknown
AA seq 158 aa
MHTGDPGSEEEDAGSSDPGMSAGRVCGPVQPEEGGDKTTSVSTVCRALFGPTDHDKNRQF
VRRELALQRQKDRETWNFDFDEGVPLTGRYDWTPVARPYASRSSTEDRKTPHRRAKSVAG
CSAGGVTQTRIPEYMKKRKQTGARNKAESSRSVSPKAE
NT seq 477 nt   +upstreamnt  +downstreamnt
atgcacaccggcgatccggggagcgaagaagaagacgcggggagctcggacccagggatg
agcgcgggccgagtgtgcggtccggtgcagccggaggagggaggagataagacgacgtcg
gtgtcgaccgtctgtcgggctctgttcggtccgaccgatcatgacaaaaatcggcaattc
gtcagaagggaattggcccttcaacgacagaaggacagggaaacttggaactttgacttc
gacgagggagtgccgctgactggaaggtacgattggacacccgtggcgcgaccctacgcg
tccaggtcctcgaccgaagacagaaaaactccgcatcgaagagccaaatcggtggccggt
tgcagcgcggggggcgtgacccaaacacgtataccagaatacatgaaaaaaaggaaacag
acgggggcaagaaacaaagcggaatcttcgaggtcggttagcccaaaggcggaataa

DBGET integrated database retrieval system