KEGG   Centruroides sculpturatus (bark scorpion): 111637441
Entry
111637441         CDS       T06064                                 

Definition
(RefSeq) bcl-2-related ovarian killer protein-like
  KO
K20017  Bcl-2 family protein
Organism
cscu  Centruroides sculpturatus (bark scorpion)
SSDB
Motif
Pfam: Bcl-2
Other DBs
NCBI-GeneID: 111637441
NCBI-ProteinID: XP_023238696
LinkDB
Position
Unknown
AA seq 242 aa
MPYRKQSLLGYVAATEEVRPGRRLPPPRRWSAAVGWRGGAVGSGGGGGAVTRGEIVEQAM
AACGRYLRFKLRSRLAAHKKLGLQRLKSVGGPAGDPPVARVSAEIRRLADELEKRHPELY
RSVIENVGLQTLNNETAVRNLFLALARRILEPEVTWGRIVALYALAGSLALDCVRLGHPE
FVPCLVQNVGTLMETNVAQWIAQQGGWKTLTTRFEKSRRLGALHLLVVAASLFVALYLVY
FA
NT seq 729 nt   +upstreamnt  +downstreamnt
atgccttaccggaaacagtcgctgctgggttacgtggcggccaccgaggaggtgagaccg
ggccggaggttgccgccgccgcgccgctggtccgccgccgtcggctggcgcggcggcgcg
gtaggcagcggcggcggcggcggcgccgtcacgcgcggcgagatcgtggagcaggcaatg
gccgcctgcggccgctaccttcgcttcaagctgcgctcgcgcctggccgctcacaagaag
ctgggcctgcagaggctgaagagcgtggggggccccgccggcgacccaccggtggcccga
gtgtcggccgagattcgccgcctggcagacgaactggagaaacgtcatccggagctgtac
cgcagcgtcatcgagaacgtgggcctgcagactctcaacaacgagacggccgtgcgcaac
ctcttcctggccctggcccggcgcatcctggaaccggaagtcacctggggacgaatcgtg
gccctgtacgccctggccggatccctggccctggactgcgtcagactgggtcatccggag
ttcgtcccctgcctggtgcagaacgtgggcacgctgatggagacgaacgtggcccagtgg
atcgctcagcagggaggatggaaaaccttaaccaccagattcgagaagtcgcgccgcctg
ggcgccctgcacttgttggtggtggcggcgagcttgttcgtcgccctgtacttggtgtac
ttcgcgtga

DBGET integrated database retrieval system