KEGG   Centruroides sculpturatus (bark scorpion): 111639868Help
Entry
111639868         CDS       T06064                                 

Definition
(RefSeq) EGF domain-specific O-linked N-acetylglucosamine transferase-like
  KO
K18134  EGF domain-specific O-GlcNAc transferase [EC:2.4.1.255]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00514  Other types of O-glycan biosynthesis
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00514 Other types of O-glycan biosynthesis
    111639868
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:cscu01003]
    111639868
Enzymes [BR:cscu01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.255  protein O-GlcNAc transferase
     111639868
Glycosyltransferases [BR:cscu01003]
 O-Glycan biosynthesis
  O-linked GlcNAc type
   111639868
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: DUF563
Motif
Other DBs
NCBI-GeneID: 111639868
NCBI-ProteinID: XP_023241588
LinkDB All DBs
Position
Unknown
AA seq 370 aa AA seqDB search
MLLYLLFLSFIHFASLKSIWDDINLPPEHMPYFFNNNLNLASLCEKNRNCPYKKYLNKKN
CWGYEKNCSLSYRYSDPICDGEAKGWVTSKKDQIHTFYTQGDFGYIKERRNELITLCLPE
HPDDSLLECSKYTRFCRARNIIFHFKSLEKLPEPIRYRDDVVQKGEVGGHCKLNKMQLKK
EGEHKSPLQSWFAELEHFTELPYRPIQDKKCDTVFTKPTFIMKLDAPVNMYHHFCDFLNL
YASLHLNNSFTTDVFILIWDTIPYRSNFEITWKAFTKHPLLNLEQFKGKRVCFKDVVFPL
LPRMIFGMYYNMPLIPGCYKSGLFHAFSKHVLHKLNIKQDEYSGKKIIITLLSRATTFRQ
ILNENELNWD
NT seq 1113 nt NT seq  +upstreamnt  +downstreamnt
atgttattatatttgctgtttctttcttttatccattttgcaagtttaaagagtatttgg
gatgatatcaatttgcctccagagcacatgccttatttctttaataataatttgaatttg
gcttcactctgcgaaaaaaataggaattgtccttataagaaatacttaaacaagaaaaac
tgttggggatatgaaaagaactgttccctaagttacagatattctgatcctatttgtgat
ggtgaagcaaaaggatgggttacgtcaaaaaaagatcagatccatactttttatactcaa
ggagattttggttacattaaagaaagaaggaatgagttaatcacattatgtttaccagaa
catcctgatgatagtttacttgaatgcagcaaatatactagattttgtagggcaaggaat
ataatttttcatttcaaatcacttgaaaaacttccagaaccaataagatatcgagatgat
gtggtacagaaaggcgaagtaggaggccattgtaaattaaataaaatgcaattaaaaaaa
gaaggagagcataagagtccacttcaatcatggtttgctgaacttgagcattttacagaa
cttccatatcgtccaattcaagataagaaatgtgataccgtgtttacgaaaccaacattt
ataatgaagcttgatgcacctgtgaatatgtatcatcatttttgtgattttttgaacttg
tatgcatccttacatttaaacaatagctttactacagatgtatttattcttatatgggac
actataccatacagaagcaattttgagattacttggaaagcatttactaagcatccatta
cttaatcttgaacagtttaaaggaaagagagtgtgtttcaaagatgttgtattcccatta
ttacctcgaatgatctttggaatgtattataacatgcctttgataccaggctgttacaaa
agtggtttattccatgctttttctaaacatgttttacataaattaaatattaagcaagat
gaatattctggaaagaaaattataattacgttattgtcaagagcaacgactttcagacag
atattgaatgaaaatgaactcaattgggattaa

DBGET integrated database retrieval system