KEGG   Centruroides sculpturatus (bark scorpion): 111640048
Entry
111640048         CDS       T06064                                 

Definition
(RefSeq) stearoyl-CoA desaturase 5-like
  KO
K00507  stearoyl-CoA desaturase (Delta-9 desaturase) [EC:1.14.19.1]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu01040  Biosynthesis of unsaturated fatty acids
cscu01100  Metabolic pathways
cscu01212  Fatty acid metabolism
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09103 Lipid metabolism
   01040 Biosynthesis of unsaturated fatty acids
    111640048
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:cscu01004]
    111640048
Enzymes [BR:cscu01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.1  stearoyl-CoA 9-desaturase
     111640048
Lipid biosynthesis proteins [BR:cscu01004]
 Desaturase
  First
   111640048
SSDB
Motif
Pfam: FA_desaturase
Other DBs
NCBI-GeneID: 111640048
NCBI-ProteinID: XP_023241819
LinkDB
Position
Unknown
AA seq 307 aa
MAPSQTFTTVTETEENAKSKKPPMEIVWKNVIAFIILHIGALYGIYLANWRTFTTASLWA
YLSILGVTGGSHRLWSHRSYKAKWPVRVFLMFFQTMAIQNDIYEWSRDHRVHHKYSETDA
DPHNAKRGFFFSHMGWLMVKKHPEVKEKGKSIDMSDLLKDPVVVFQRKYYYILVFLISVV
IPTMVPILYWGESFWSSLFTQFFSRYVVSLHGTWLVNSAAHMWGTRPYDRFINPRESPIV
HMFSIGEGFHNYHHTFPWDYCTSEFGWKLNSTALFIDCMAWLGLVYDRKRASPEIIQQRK
ERTGEKL
NT seq 924 nt   +upstreamnt  +downstreamnt
atggctcctagtcaaacttttactacagtaacagaaactgaagaaaatgcaaaatctaaa
aaaccaccaatggaaattgtatggaaaaatgtaatagcatttattattttacatattgga
gctctttatggtatttatcttgcaaattggagaacttttacaactgcatcattatgggca
tatttaagcattttgggagtaactggaggatctcatagactatggtctcatcgtagttac
aaagcaaagtggcctgttagagtatttcttatgttctttcaaaccatggccattcagaac
gatatctacgaatggagcagagatcacagagttcatcacaaatattccgaaacagatgcg
gatccacacaatgctaagagaggattcttcttctctcatatgggatggctaatggttaaa
aaacatccggaagtaaaagagaaagggaaaagtattgacatgagcgatcttctcaaagat
cccgtcgttgtgtttcagagaaagtattattacatattagtatttctgatatccgtagtg
ataccaacaatggttcccattctttactggggcgaaagcttttggagttcactttttact
caatttttcagccgttacgttgtgtccttgcatggaacatggttggtaaacagtgccgct
cacatgtggggtactagaccatacgatagatttataaatccaagagaaagtccaatagtt
catatgttttcaattggagaaggttttcataattatcatcacacgtttccatgggattac
tgtaccagtgagttcggatggaaattaaattcaactgctctctttattgattgtatggca
tggttaggattagtttatgacagaaaaagagcatccccagaaataattcaacagagaaaa
gaaagaacgggagagaaattatag

DBGET integrated database retrieval system