KEGG   Centruroides sculpturatus (bark scorpion): 111640263Help
Entry
111640263         CDS       T06064                                 

Definition
(RefSeq) NADP-dependent malic enzyme-like
  KO
K00029  malate dehydrogenase (oxaloacetate-decarboxylating)(NADP+) [EC:1.1.1.40]
Organism
cscu  Centruroides sculpturatus (bark scorpion)
Pathway
cscu00620  Pyruvate metabolism
cscu01100  Metabolic pathways
cscu01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:cscu00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00620 Pyruvate metabolism
    111640263
Enzymes [BR:cscu01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.40  malate dehydrogenase (oxaloacetate-decarboxylating) (NADP+)
     111640263
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Malic_M malic
Motif
Other DBs
NCBI-GeneID: 111640263
NCBI-ProteinID: XP_023242033
LinkDB All DBs
Position
Unknown
AA seq 567 aa AA seqDB search
MGGNNQGMKLNGCENCSGETTQKRGISYLKDARSYKGLAFSRQEREHLGFRGLLPAAVRK
MQDQVQIVLKNLDIYSDDFSRYIYLRDLQDNNEQLFYRVMAEHTDRLMPIVYTPIVGTAC
QNYHIIFRRPRGLFINIEDSGHIEEILDNWPANNVKAIVVTDGERILGLGDLGANGMGIP
VGKLSLYTALSGLPPYLTLPVTLDVGTNNEKLLNDPFYIGLRQKRVRGEKYDNFVEEFMQ
AVKKQYGQFCLIQFEDFANSNAFRFLKKYRDNYCTFNDDIQGTASVAVAGLFASMKITGK
KLVENTFLFVGAGEANLGTADLLVMAMEKEGVSTKDAADRVWMTDSKGLLVKDRPSGGID
AHKGKYAKDYKPMTDLEEMVKTIKPTALLGASAQTGLFTKNVLQGMLDNCDRPIIFALSN
PTDKAECTAEEAYTYTDGKCIFASGSPFDPVTYKGKTFCPGQGNNAYIFPAVGLAVTSVN
VPHISNEVFLVAAQALADLVTEEQMNEGRVYPPQSLLREVSDNIAAKLIDYFYRQRVATL
LPEPTDKLAFLKTVQYDYNYREKPTEY
NT seq 1704 nt NT seq  +upstreamnt  +downstreamnt
atgggaggaaacaatcaaggcatgaagttgaacggctgcgaaaattgttcaggtgaaact
acccagaagagaggtatctcctacctgaaagatgccagaagttacaagggattggcattc
tctcgacaagaaagggaacatctgggctttcgtggtctattaccggcagcagtacgtaag
atgcaagatcaagtacagatagtgctgaagaatttggatatatacagcgatgatttcagt
cgttacatatatttacgtgatttgcaggataacaatgaacaattattttatcgagtcatg
gctgaacacaccgacagactaatgccaatagtatacactccaattgtgggaacagcttgc
cagaattaccacataatatttcgtcgtccaagaggtcttttcattaatattgaagactct
ggccacattgaagagatactggacaattggccagcaaataatgtgaaagctattgtagtt
actgatggagagcgaatattgggactcggagatcttggagcaaacggaatggggatacca
gtcggtaaactgtctctgtacacggcactttcgggcttacctccttatcttactctccca
gtcactttagacgttggaacaaataatgagaaattgttgaatgatcccttctatattggt
ctcagacaaaagagagttagaggtgaaaaatatgataattttgtagaggaatttatgcaa
gctgtgaagaaacaatacggacaattttgtcttatccaatttgaagactttgccaacagt
aatgcctttcgtttcttgaagaaatacagagataattactgcacttttaatgatgatatt
cagggaacagcatcggttgctgttgccggcttatttgcaagtatgaaaatcacaggaaag
aaattggtagaaaatacattcctctttgtaggtgcaggtgaggctaatttgggcactgcc
gacttgcttgtgatggctatggagaaagaaggagtttctactaaggatgccgctgacaga
gtttggatgaccgattctaaaggtcttcttgtaaaggacaggccttcaggtggtatcgat
gcccataaaggaaagtatgcaaaagattataaacccatgactgatttggaggagatggtg
aaaactataaaaccaactgctttgctaggtgcttctgctcagactggactattcacaaaa
aatgtattgcaaggaatgctagataactgtgatcggccaattatttttgctctaagtaat
cctacagacaaagcagaatgtacagctgaagaagcctacacttatactgatggaaaatgt
atatttgctagtggaagtccatttgatccagttacttacaagggtaaaacattctgtccg
gggcaaggcaacaatgcatacatatttccagccgtaggattagccgttacatccgttaac
gtaccccacatttccaatgaagtctttttagtagcggctcaagctcttgccgatctagta
acagaagaacagatgaacgaaggaagagtttatcctccgcaatctctactcagagaagta
tctgataatattgctgcaaagctgatagattacttttacagacaacgcgttgccaccctc
cttccagaacccacagacaaacttgcttttctgaagaccgtacaatatgattataattat
agagagaaaccaacagaatattaa

DBGET integrated database retrieval system