KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Clst_0178Help
Entry
Clst_0178         CDS       T02527                                 

Definition
(GenBank) permease
  KO
K07090  uncharacterized protein
Organism
csd  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Brite
KEGG Orthology (KO) [BR:csd00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    Clst_0178
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: TauE
Motif
Other DBs
NCBI-ProteinID: AGI38287
UniProt: L7VKE9
LinkDB All DBs
Position
197438..198193
Genome map
AA seq 251 aa AA seqDB search
MDATFFLFLIAGFIAQVIDGCIGMAYGVSSTSLLLSFGVPPAAASASVHTAEVFTTFVSG
ISHYKLKNVDKKLFASLVVPGVIGGIVGAYILSNIDTTIIEPVINVYLIVMGVRIIVKAF
VKPGDEAAKKLEGVRLYILGVLGGFLDAIGGGGWGPVVTTTLVAGGNTPRYVIGSVNASE
FFVTLAQTITFITAVGFGEYGKIILGLAAGGILAAPFAAYLVRKISPKLMMILVGTVVAA
LNIRNIILMLV
NT seq 756 nt NT seq  +upstreamnt  +downstreamnt
atggatgcgacttttttcctgtttctgattgcggggtttatagcccaggtaattgacggc
tgtataggcatggcttacggcgtgagctcaacaagtcttttgctcagctttggagtgccg
ccggccgcagcaagcgcgtcggtacatacggctgaggtttttacaacgtttgtttcggga
atctcccattacaagcttaaaaacgtggataaaaagttatttgcctcgctggtcgttccg
ggagtaatcggcggaattgtgggtgcttacatcctgtcaaatattgatacgacgataatt
gagccggttataaacgtatacctcattgtaatgggggtgcggataattgttaaagctttt
gtgaagccaggcgatgaggcggcaaaaaaactggaaggggtcagactgtatattcttggc
gttttgggcggttttctcgatgcaataggaggcggaggatggggaccggtggttacgacc
acccttgttgcaggcggcaatactccaaggtatgtaatcggttcggtgaatgcgtcggaa
ttctttgtaaccttggcccagacaataacgtttattacagcagtcggtttcggggaatac
ggcaaaataatactgggacttgcggcgggaggtattttggctgcgccttttgcggcatat
cttgttaggaaaatttcgccaaagctgatgatgattttggtgggtaccgtagttgccgca
ttaaacataaggaatataattcttatgctggtttag

DBGET integrated database retrieval system