KEGG   Clostridium stercorarium subsp. stercorarium DSM 8532: Clst_0890Help
Entry
Clst_0890         CDS       T02527                                 

Definition
(GenBank) maltodextrin phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
csd  Clostridium stercorarium subsp. stercorarium DSM 8532
Pathway
csd00500  Starch and sucrose metabolism
csd01100  Metabolic pathways
csd01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:csd00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    Clst_0890
Enzymes [BR:csd01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     Clst_0890
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF3417 Phosphorylase Iron_transport
Motif
Other DBs
NCBI-ProteinID: AGI38964
UniProt: L7VN76
LinkDB All DBs
Position
complement(987551..990115)
Genome map
AA seq 854 aa AA seqDB search
MHILGKIKVTAKLPEEISKLKDLAYNLWWTWNHEACELFREIDPELWEQTDKNPVHMLQV
IHPEKLSEKTSDSRFMEKYADVINRFERYMARKDTWFALNFPDRMSERIIYFSAEYGFHE
ILPIYSGGLGILSGDHCKTASDLGLPLTAIGLLYKQGYFNQRINRDGWQETEFAELDPSR
LPILPVTKSDGKPLLISVEMPNRIVYARVWKMAVGRVDLYLMDTDIPENNRFDRTITYRL
YGGDRETRIQQEILLGIGGIRLLDELNIHGTVYHMNEGHSAFIGFELCRKLIEESNLSFD
EAREMVASSTVFTTHTPVPAGSDVFSLDMIDRYFSNYYSQLRVSRDEFISLGLKPGDPYN
FNMTVLALKMSGKRNGVSALHGAVSRNIYSSLWPDIPENEIPIQHVTNGVHIKTWLAYEF
QRLLDKYFPENWYDRIHEPKIWEAMDQIPDREIWEIHLQLKRKMIDYVKNKLKKQLISNG
IPVPEAERHASEIKTDAFTIGFARRFATYKRASLIFRDMARIERILNNHEMPVQVIFAGK
AHPADRPAHEIIKQIHDIARHEGFNGKIFLIENYNMALARYLVQGVDLWLNNPRRPLEAS
GTSGQKAGINGIPNLSIADGWWCEGYNGKNGWVISDGMQYENEEQQDDADSKSLYWLLEN
KIIPLYFKRNEDGVPTEWVKIMKESIKSVAPMFSTHRMLSDYTRAYYIPCIDRVERIKQS
NYNFIRNLSVFKHNIRKFWHDIRITSENRADFPVEHSIRSGETVTLNATVYLGNLSPDDV
AVEVYYGPLENNQIQNGMTTEMDFMKRSESSACHYSVNLKITEGGEYGYTFRVIPKHSEL
FNKHDIPFIKWADK
NT seq 2565 nt NT seq  +upstreamnt  +downstreamnt
atgcatatactgggaaaaataaaggtaacggcgaaactgccggaagaaatttcaaaactt
aaggatctggcctataacctgtggtggacatggaatcatgaagcctgtgaacttttcagg
gaaattgatccagagttatgggaacagaccgataagaatcctgttcacatgcttcaggtg
attcatcccgaaaaactttccgaaaaaacatctgacagtcgtttcatggaaaaatacgcc
gatgtcataaaccggtttgaaaggtacatggcccggaaagacacatggtttgcactcaat
ttccccgacagaatgtcggaacggataatatatttctccgccgaatacggcttccacgaa
atacttccgatatattcgggaggtttgggcatcttatccggggatcactgcaaaacggca
agcgatttgggcctccctttaaccgcaataggactcctgtacaagcagggatatttcaat
cagcgcataaaccgtgacggatggcaggaaaccgaatttgccgaactggatccatcacgg
cttccaatccttcctgtaacgaaaagcgacggcaaaccgctgttaataagcgtcgaaatg
cctaacaggattgtttatgcaagagtttggaaaatggcggtcggacgtgttgatttatat
cttatggacacggatatacctgaaaacaaccggtttgacaggacaataacctacagactg
tacggcggagacagggaaacgcgaatacagcaggaaattcttcttggcattggaggaatc
agactgctggacgaattaaacatccacggaacggtttatcacatgaatgaggggcattcg
gcatttatagggtttgaactttgcagaaaactcattgaagaatccaatctttcctttgac
gaggcaagagaaatggttgcctcttcaacggtattcacaacgcatactcctgtccccgcc
ggaagcgatgttttttcccttgacatgattgaccggtatttcagcaattattacagccag
ctgcgcgtaagccgtgacgaattcatttcccttgggctcaaacccggcgatccttataat
ttcaatatgacggtgctggctttgaaaatgtcgggaaagcgaaacggagtaagtgcgctt
cacggcgcggtatccagaaatatttacagcagtttgtggccggatattcctgaaaatgaa
attcccattcagcacgtaacgaacggagttcatataaaaacatggttagcctatgaattt
cagcggcttctggacaaatatttccccgaaaactggtatgacagaattcatgagccaaaa
atatgggaagcaatggaccaaatacccgacagggaaatatgggaaatacacctccaactg
aaaagaaaaatgatcgattatgtgaaaaacaaactgaaaaaacagttgatatccaatggg
atacccgttccggaagcagaacggcatgcctcggaaattaagacggatgcctttacgata
ggatttgccaggcgttttgccacatataagcgggcttcccttatattcagggacatggca
aggatcgaacgaatacttaacaaccatgaaatgccggtacaggtaattttcgccggaaag
gcacatcctgccgacaggcccgcccatgaaataataaaacagatacatgacatagccaga
cacgaaggttttaacggcaagatttttcttatagaaaactacaatatggctctcgcaaga
tacctcgtgcagggtgtagacctgtggcttaacaacccccggcgtccccttgaggccagc
ggcacaagcggccagaaagcaggtattaacggcataccgaatttaagcatcgccgacggc
tggtggtgcgaaggctacaacggcaaaaacggctgggttataagtgacggcatgcagtat
gaaaatgaagaacagcaggatgacgcggacagtaaatccctttactggctgcttgaaaac
aaaataattcccctgtatttcaaaagaaatgaagacggcgttccgaccgaatgggttaaa
atcatgaaggaatcaattaagtccgtcgccccaatgttcagtacccaccgcatgctgtcg
gattatacacgcgcatattacattccgtgcattgacagggtggaaagaataaaacagtca
aattacaattttataaggaacctttcagtgttcaagcacaatataagaaaattctggcat
gatatcagaataacgtcggaaaaccgcgctgactttccggttgagcacagtataaggtca
ggtgaaaccgttaccctcaatgcaacggtttatttggggaatttgtctccggacgatgtc
gcagtcgaagtgtactacggcccgttggagaataatcaaatccaaaacggcatgaccacc
gaaatggatttcatgaaacggtcggaatcttcagcctgtcattattcggtgaatctcaaa
attaccgaaggcggagaatacgggtatacttttcgggtaattccgaaacacagcgaactg
ttcaacaaacatgatataccgtttataaaatgggccgacaaataa

DBGET integrated database retrieval system