KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Clst_1497Help
Entry
Clst_1497         CDS       T02527                                 

Definition
(GenBank) transcriptional regulator
Organism
csd  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Response_reg GerE Sigma70_r4_2 Sigma70_r4 Sigma70_ECF HTH_23 HTH_40 HTH_29 Mga HTH_24 HTH_10 Phage_terminase Caleosin HTH_11 Phage_int_SAM_3 DUF2089
Motif
Other DBs
NCBI-ProteinID: AGI39552
UniProt: L7VQ28
LinkDB All DBs
Position
complement(1680393..1681043)
Genome map
AA seq 216 aa AA seqDB search
MDKIRVMLVEDHSMVRQGLKQLIELESDIKVVAEAANGTQAADYYQIEKPDVVLMDINMP
KKNGLQALELIKQNDPDAKIIMLTIHSDREYLFEALQLGASGYVLKDADGYVLIEAIRKV
YEGEMYIQPTMAKELVMEFKRYAHNGKNSSKKENILSEREIEVLRLVAKGLLNKEIAQTL
YISEKTVKNHISNIFKKLKVSDRTQAAVYALKHNLI
NT seq 651 nt NT seq  +upstreamnt  +downstreamnt
atggataaaatacgggtaatgctggtagaagatcattccatggttcgtcaggggcttaag
cagttaatagagctggaaagcgacattaaagtagtggcggaagccgccaatggtacccag
gctgccgattattaccagattgagaaacccgatgtggtattaatggatataaatatgcct
aaaaagaacgggttgcaggctttggaacttattaagcaaaatgatcctgatgccaaaatt
attatgcttaccatccattcagacagggaatatttgtttgaagcgctgcagcttggcgcc
agcggctatgtacttaaggatgcggatggatatgtgcttattgaggcgataagaaaggta
tacgaaggcgaaatgtacattcagcccacaatggcaaaggaacttgttatggaatttaag
agatatgcgcataacgggaaaaactcttcaaagaaggaaaatatcctgagcgagagggaa
atcgaggtattaaggcttgtagcgaaggggctgttaaacaaggaaatagcgcagactctt
tatatcagtgaaaaaacggtaaaaaaccatatttctaatatcttcaaaaaattaaaagtt
tcggacagaactcaggcagcagtttatgcattgaagcataacctgatttga

DBGET integrated database retrieval system