KEGG   Thermoclostridium stercorarium subsp. stercorarium DSM 8532: Clst_2406Help
Entry
Clst_2406         CDS       T02527                                 

Definition
(GenBank) alanine racemase
  KO
K01775  alanine racemase [EC:5.1.1.1]
Organism
csd  Thermoclostridium stercorarium subsp. stercorarium DSM 8532
Pathway
csd00473  D-Alanine metabolism
csd01100  Metabolic pathways
csd01502  Vancomycin resistance
Brite
KEGG Orthology (KO) [BR:csd00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00473 D-Alanine metabolism
    Clst_2406
 09160 Human Diseases
  09175 Drug resistance: Antimicrobial
   01502 Vancomycin resistance
    Clst_2406
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01011 Peptidoglycan biosynthesis and degradation proteins [BR:csd01011]
    Clst_2406
Enzymes [BR:csd01000]
 5. Isomerases
  5.1  Racemases and epimerases
   5.1.1  Acting on amino acids and derivatives
    5.1.1.1  alanine racemase
     Clst_2406
Peptidoglycan biosynthesis and degradation proteins [BR:csd01011]
 Precursor biosynthesis
  Racemase
   Clst_2406
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ala_racemase_N Ala_racemase_C
Motif
Other DBs
NCBI-ProteinID: AGI40427
LinkDB All DBs
Position
complement(2712788..2713966)
Genome map
AA seq 392 aa AA seqDB search
MSFNYYRAWAEINLDNIAHNVREVAKRVGKMTEIMAVVKADAYGHGVFETVPTLLENGAS
RLAVSMLDEAIQLREFGIKVPILVLGYTEPSRAEDIIKYNITQTVFSHELAKALSDAAVK
LGRQAKIHIKIDTGMGRVGFKPGYGAVKDVVRISELPGIIIEGLFSHFASADEADPEYTR
LQFERFESIVQELNRIGILIPVKHIANSAAVIQYPNLHLNMVRPGIILYGLYPSDEVDRK
LIDIRPAMELKAKVVHVKEVEEGTPISYGRTFVTKRKSRIATLPIGYADGFSRLLSNKGR
VLIHGQYAPIVGTICMDQCMVDVTDIDGEVKTGDEAVIFGVQGNNRITVEEIAELCNTIN
YEVVCLIGKRIPRVYLRGGKVVNVVNYLRQTF
NT seq 1179 nt NT seq  +upstreamnt  +downstreamnt
ttgagctttaactattacagggcatgggctgaaatcaatttggacaatatagcgcataat
gtaagggaagtggcaaaacgagtaggtaaaatgactgaaataatggcggtggttaaagcc
gatgcttatggccatggcgtgtttgaaacggttcccactcttttggaaaacggagcaagc
aggcttgcggtttcaatgctggacgaggcaatccagttaagggagtttggtataaaggtt
ccaattctggtgttaggctataccgaaccgtcgagagccgaagatattattaaatataac
attacacagacggtttttagccatgagcttgcaaaagctttgtccgatgccgcggttaag
ctgggcaggcaggcgaaaatacatataaaaatagacaccggaatgggcagagtaggtttt
aagcccggatacggtgcggtaaaagacgtagttagaataagcgaacttccgggtataatt
atagagggactgttcagccattttgcttcggccgatgaagccgacccggaatatacgagg
ctccagttcgaacgctttgaaagcattgtccaggagcttaaccggataggaatattaatt
cccgtgaaacatattgccaacagtgccgctgtaatccaatacccaaacctgcatctgaac
atggtgcggcccggcataattctttacggactgtatccgtccgacgaggtggacaggaaa
cttattgacatcaggccggcgatggagctgaaggcaaaggttgtgcatgtcaaggaagtg
gaggaaggaacgccgataagctatggccggacattcgtgacaaagcggaaaagccgcata
gcgacattgccgatagggtatgctgacggtttctcaaggcttctttcaaacaaaggccgg
gtgttgatacatgggcagtatgcccctatcgtggggacgatctgtatggatcagtgcatg
gttgatgtcacggatatagacggggaagtgaagacaggagatgaagcggtgatattcggt
gttcagggaaataacaggataaccgttgaagagatagcggagctttgcaatactataaat
tacgaggttgtatgtctgataggaaaaaggatcccacgggtttatttaagaggcggaaag
gttgtcaatgtggtgaattacctcaggcaaactttttaa

DBGET integrated database retrieval system