KEGG   Caulobacter segnis: Cseg_0572Help
Entry
Cseg_0572         CDS       T01221                                 

Definition
(GenBank) alkyl hydroperoxide reductase, F subunit
  KO
K03387  NADH-dependent peroxiredoxin subunit F [EC:1.8.1.-]
Organism
cse  Caulobacter segnis
Brite
KEGG Orthology (KO) [BR:cse00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    Cseg_0572
Enzymes [BR:cse01000]
 1. Oxidoreductases
  1.8  Acting on a sulfur group of donors
   1.8.1  With NAD+ or NADP+ as acceptor
    1.8.1.-  
     Cseg_0572
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Pyr_redox_2 Pyr_redox_3 Pyr_redox GIDA Thioredoxin_3 FAD_binding_2 HI0933_like FAD_oxidored AlaDh_PNT_C NAD_binding_7 Glutaredoxin K_oxygenase FAD_binding_3 DAO FMO-like NAD_binding_8 Thi4
Motif
Other DBs
NCBI-ProteinID: ADG09084
UniProt: D5VHV3
LinkDB All DBs
Position
complement(610279..611862)
Genome map
AA seq 527 aa AA seqDB search
MLDAGLKTQLTTYLQNLRQPIELVASLDDSSGSAEMKALLEDIVATSDKVSLNLAGDNER
KPSFAITRAAGDADVRFAGLPLGHEFTSLVLALLHVGGHPPRLDAEVIERIKGLDGDYRF
ETYFSQSCQNCPDVVQALNTMSALNPRIRHVAIDGAFFKAEVEERQVMAVPTILLNGQPF
GQGRMDVEQILAKLDTGAADRMAEKIKAKDAFEVLVIGGGPAGAAAAIYAARKGIRTGVA
AERFGGQVLDTMDIENFISVSHTEGPKLASALEQHVKDYEVDVMNLQKAVGLVPAKTPGG
LIEIKLENGASLKSKSVILSTGARWRNVNVPGEAEYKNKGVAYCPHCDGPLFKGKRVAVI
GGGNSGVEAAIDLAGIVAHVTLIEFDSQLRADAVLQRKLASLPNVKIVTSAMTTEIHGDG
ARVNGLSYKDRNGDAVHRVDLEGVFVQIGLVPNTEWLKDSGVALTPRGEIEVDYRGETSI
PGVFAAGDATTAPYKQIIIAMGEGAKASLSAFDYLIRLPAEASQVAA
NT seq 1584 nt NT seq  +upstreamnt  +downstreamnt
atgctggacgccggtctgaagacccagctgaccacctatctgcagaacctgcgccagccg
atcgaactggtcgcgtctctggacgactcttccggctcggccgagatgaaggcgctgctg
gaagacatcgtcgccacctcggacaaggtcagcctgaacctggccggcgacaacgaacgc
aagccgtcgttcgccattacgcgcgccgcgggcgacgctgacgtgcgcttcgccggcctg
ccgctgggccacgagttcacctcgctggtgctggccctgctgcacgtcggcggtcacccg
ccgcgcctcgacgccgaggtgatcgagcgcatcaagggcctagacggcgactaccgcttc
gagacctatttctcgcagtcgtgccagaactgccccgacgtggtgcaggcgctgaacacg
atgagcgccctgaacccgcgcatccgccacgtcgccatcgacggcgccttcttcaaggcc
gaggtcgaggaacgccaggtgatggccgtgccgaccatcctgctgaacggccagccgttc
ggccagggccgcatggacgtcgaacagatcctggccaagctggacaccggcgccgccgac
cgcatggccgagaagatcaaggccaaggacgccttcgaggtgctggtcatcggcggcggt
cccgccggcgcggccgcggccatctacgccgcccgcaagggcattcgcaccggcgtcgcg
gccgagcgcttcggcggccaggtgctggacaccatggacatcgagaacttcatctcggtc
tcgcacaccgaaggcccgaagctggcctcggcgctggagcagcacgtcaaggactacgaa
gtcgacgtgatgaacctgcagaaggccgtgggcctggttccggccaagaccccgggcggc
ctgatcgagatcaagctcgagaacggcgccagcctgaagtccaagagcgtgatcctgtcg
accggcgcccgctggcggaacgtcaacgtgcccggcgaggccgagtacaagaacaagggc
gtggcctactgcccgcactgcgacggcccgctgttcaagggcaagcgcgtggcggtgatc
ggcggcggcaacagcggcgtcgaggcggccatcgacctggccggcatcgtggcgcacgtg
acgctgatcgagttcgacagccagctgcgcgccgacgccgtgctccaacggaaattggcc
agcctgccgaacgtcaagatcgtcacctcggccatgacgaccgagatccacggcgacggc
gcccgcgtgaacggcctgtcctacaaggaccgcaatggcgacgccgtccaccgcgtcgac
ctcgaaggcgtgttcgtgcagatcggcctggtgcccaacaccgagtggctgaaggactcg
ggcgtggccctgaccccgcgtggcgagatcgaggtcgattatcgcggcgagacgtcgatc
cccggcgtgttcgccgccggcgacgcgaccaccgccccgtacaagcagatcatcatcgcc
atgggcgaaggcgccaaggcctcgctctcggccttcgactacctgatccgcctgccggcc
gaggcgtcgcaggtcgcggcgtag

DBGET integrated database retrieval system