KEGG   Caulobacter segnis: Cseg_1482Help
Entry
Cseg_1482         CDS       T01221                                 

Definition
(GenBank) translation elongation factor Tu
  KO
K02358  elongation factor Tu
Organism
cse  Caulobacter segnis
Brite
KEGG Orthology (KO) [BR:cse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03012 Translation factors [BR:cse03012]
    Cseg_1482
   03029 Mitochondrial biogenesis [BR:cse03029]
    Cseg_1482
  09183 Protein families: signaling and cellular processes
   04147 Exosome [BR:cse04147]
    Cseg_1482
Translation factors [BR:cse03012]
 Eukaryotic Type
  Elongation factors
   Cseg_1482
 Prokaryotic Type
   Cseg_1482
Mitochondrial biogenesis [BR:cse03029]
 Mitochondrial DNA transcription, translation, and replication factors
  Mitochondrial transcription and translation factors
   Mitochondrial translation factors
    Cseg_1482
Exosome [BR:cse04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   Cseg_1482
  Exosomal proteins of breast cancer cells
   Cseg_1482
  Exosomal proteins of colorectal cancer cells
   Cseg_1482
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GTP_EFTU GTP_EFTU_D3 GTP_EFTU_D2 MMR_HSR1 cobW RsgA_GTPase
Motif
Other DBs
NCBI-ProteinID: ADG09972
UniProt: D5VFW9
LinkDB All DBs
Position
1587785..1588975
Genome map
AA seq 396 aa AA seqDB search
MAKEKFERTKPHCNIGTIGHVDHGKTTLTAAITITLAKSGGATAKNYADIDAAPEEKARG
ITINTAHVEYETANRHYAHVDCPGHADYVKNMITGAAQMDGAILVVSAADGPMPQTREHI
LLARQVGVPALVVFMNKVDMVDDEELLELVEMEVRELLSSYQFPGDDIPITKGSALAAVE
GRDAKIGEDAILALMASVDEYIPQPERPVDLPFLMPVEDVFSISGRGTVVTGRVERGIVK
VGEEVEIVGIRPVQKTTCTGVEMFRKLLDQGQAGDNVGVLLRGTKREDVERGQVLCKPGS
ITPHTKFVAEAYILTKEEGGRHTPFFTNYRPQFYFRTTDVTGIIKLREGVEMIMPGDNAE
LDVELITPIAMEEKLRFAIREGGRTVGAGVVAKIVE
NT seq 1191 nt NT seq  +upstreamnt  +downstreamnt
atggccaaggaaaagttcgaacgtactaagccgcactgcaacatcggcaccatcggtcac
gttgaccatggcaagaccacgctgacggccgcgatcacgatcacgctggcgaagtcgggc
ggcgcgaccgccaagaactacgccgacatcgacgccgcgccggaagaaaaggcccgcggc
atcacgatcaacaccgcccacgtcgagtacgagacggccaaccgtcactacgctcacgtc
gactgccccggccacgccgactacgtgaagaacatgatcaccggcgccgcccagatggac
ggcgcgatcctggtcgtgtcggccgccgacggcccgatgccgcagacccgcgagcacatc
ctgctggcccgtcaggtcggcgtgcccgccctggtcgtgttcatgaacaaggtcgacatg
gtcgacgacgaagagctgctcgagctcgtcgaaatggaagttcgtgagctgctgtcgtcc
taccagttcccgggcgacgatatcccgatcaccaagggttcggccctggccgcggtcgaa
ggccgtgacgccaagatcggcgaagacgccatcctggccctgatggcctcggtcgacgag
tacatcccgcagccggaacgtccggtcgacctgcccttcctgatgccggtcgaagacgtg
ttctcgatctcgggccgcggcaccgtggtgaccggtcgcgtcgagcgcggcatcgtgaag
gtcggtgaagaagtcgaaatcgtcggcatccgtccggtccaaaagaccacctgcacgggc
gtcgaaatgttccgcaagctgctggaccaaggtcaagccggcgacaacgtgggcgtgctg
ctgcgcggcaccaagcgtgaagacgtcgagcgcggccaagtgctctgcaagccgggttcg
atcaccccgcacacgaagttcgtggccgaagcctacatcctgaccaaggaagaaggcggc
cgtcacaccccgttcttcaccaactaccgtccgcagttctacttccgcacgacggacgtg
acgggcatcatcaagctgcgcgaaggcgtggaaatgatcatgccgggcgacaacgccgag
ctggacgtcgagctgatcaccccgatcgccatggaagagaagctgcgcttcgccatccgt
gaaggcggccgcaccgtcggcgccggcgtcgtcgccaagatcgtcgagtaa

DBGET integrated database retrieval system