KEGG   Caulobacter segnis: Cseg_1867Help
Entry
Cseg_1867         CDS       T01221                                 

Definition
(GenBank) hypothetical protein
Organism
cse  Caulobacter segnis
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: ADG10340
UniProt: D5VJD1
LinkDB All DBs
Position
2033406..2034656
Genome map
AA seq 416 aa AA seqDB search
MSRYLISAVEQALWSLLNFGVNLLLIRFVAPDQYGAFVFWASCGFVLSSLQNALTVCHLQ
ALAPGGGLDPKRLPVERLMHGVNAIFLLVAALACLVGAVAWRSVDSPYGALAATLFVPAF
LLQQYLRALAFSRGRADVATGQTAGVFALVALLLGEALLRGGKLDADGVLWRLGVAYGLT
GALGAVWALRGQGGRLRRYELKAYGDYVRQSGWVFLGVSSTELLTRFYVFVVAGWFGAAA
LAALSATQQLLRPVPLLAMSWSMVARNDLARRRDHEAWSDFVRILAVAMGGGLVVAAAWT
LILHLAWPAIATHLFAGKYLTDRWMVALWGLSAAFTLGQTVVSTGLQVLRAFKPLALANG
AASLVAAGGILLVMRGLGPAGAIVGTAAGQLLELAAMTAILMSITAARRRSAPREA
NT seq 1251 nt NT seq  +upstreamnt  +downstreamnt
atgtcccgctatctgatctccgctgtggagcaggccctttggtctttgctcaatttcggc
gtcaatctgctgttgatccgcttcgtcgcgcccgaccagtacggcgcgttcgtgttctgg
gcgtcctgcggcttcgtgctgtccagtctgcagaacgccctgaccgtatgccatctgcag
gcgttggcgccgggcggggggctggatcccaagcggttgcccgtcgagcgtctgatgcac
ggcgtcaacgccatctttctcctggtcgcggccttggcgtgcttggtcggcgccgtggcg
tggcggagcgtcgacagtccatacggcgcgctggcggccaccttgttcgtgccagccttt
ctgttgcagcaatatctgcgggcgttggcgttctcgcgtggacgtgcggacgtggcgacg
gggcagaccgctggagtcttcgcccttgtggcgctcctgctgggcgaagctctgcttcgg
ggcggaaagctcgacgccgacggcgtcctctggcgcttgggcgtcgcctacggcttgacc
ggcgcccttggcgcggtctgggccttgcgggggcagggcggccgacttcgccgctacgag
ctcaaggcctatggcgactatgttcggcagtccggctgggtgttcctgggggtctcgagc
accgaacttctgacccggttctacgtgttcgtcgtggcgggctggttcggcgcggcggct
ctggcggccttgtcggcgacccagcagctgttgcggcccgtcccgctgctggcgatgtcc
tggagcatggtggcccgcaacgatctggctcgccgccgagatcatgaggcgtggagcgac
ttcgtccggatcctggcggtggcgatgggcggcgggctggtggtcgccgcggcgtggacc
ctgatcctgcacctggcctggccggcgatcgccacgcacctgttcgcaggcaagtatctg
accgaccgctggatggtcgctctgtgggggctgagcgcggccttcaccctggggcaaaca
gtggtgagcaccggtctccaggtgctgcgagccttcaagcctttggcgctggccaacggg
gcggcctccttggtggcggccggtggaatcctgctggtcatgcgcggccttggaccagcc
ggcgccatcgtcgggacggctgcgggtcagttgctggagctggcggccatgaccgccatc
ctgatgtcgatcaccgcggcgagacggcgatcggcgccgcgcgaggcctag

DBGET integrated database retrieval system