KEGG   Caulobacter segnis: Cseg_2891Help
Entry
Cseg_2891         CDS       T01221                                 

Definition
(GenBank) Hsp33 protein
  KO
K04083  molecular chaperone Hsp33
Organism
cse  Caulobacter segnis
Brite
KEGG Orthology (KO) [BR:cse00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:cse03110]
    Cseg_2891
Chaperones and folding catalysts [BR:cse03110]
 Heat shock proteins
  HSP33
   Cseg_2891
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: HSP33
Motif
Other DBs
NCBI-ProteinID: ADG11338
UniProt: D5VLG5
LinkDB All DBs
Position
complement(3147332..3148243)
Genome map
AA seq 303 aa AA seqDB search
MTDIASTPGVLDDVVSAFQIEGLPVRGRVVRLGQAVDEVLTRHAYPEPVANLLGEACALA
ALVGSSLKFEGRLIIQAQGDGPVRYVVVDYDTSGGLRGYCRFDPEEVAAASEGFTRPGAK
TLLGGGVFIMTLDQGSDMDRYQGVTPIEGETLALCAEQYFAQSEQTPTRIRLAVGQVDTG
EGPQWRAGGILIQVIAGDQARGDTQDAWRHVTALFETTGEDELIDPTVTTPTLLWRLFNE
DGVRLLDEKPLRAFCRCSEDRIGVVMDSFSAEEVEEMIEPDGKIHVTCEYCSRVYKLDPP
TAG
NT seq 912 nt NT seq  +upstreamnt  +downstreamnt
atgaccgacatcgcttccactccgggcgtcctcgacgacgtcgtttccgcgttccagatc
gaaggactgcccgtgcgcggccgcgtcgttcggctgggccaggccgtcgacgaggtgctg
acgcgccacgcctatcccgagcccgtggccaacctgctgggcgaggcctgcgcgctcgcg
gccctcgtgggctccagcctgaagttcgaagggcgtctgatcatccaggcccagggcgat
ggcccggtgcgctacgtagtggtggattacgacacctcgggcggcctgcgcggctattgc
cggttcgatccggaagaggtcgccgccgcttccgaaggtttcacgcgtcccggcgccaag
accctgctgggcgggggcgtcttcatcatgaccctggatcagggttcggacatggaccgc
taccagggcgtgacgccgatcgagggcgagacgctggccctgtgcgccgagcagtatttc
gcccagtcggaacagaccccgacccgcatccgtctggccgtgggccaggtcgatacgggc
gagggccctcaatggcgcgccggcggcatcctgatccaggtcatcgcgggcgaccaggcg
cgcggcgacacccaggacgcctggcggcacgtcacggcgctgttcgagaccacgggcgag
gacgagctcatcgacccgaccgtcacgaccccgaccttgctgtggcgcctgttcaacgag
gacggcgtgcgcctgctcgacgaaaagccactgcgcgccttctgccgctgctccgaggat
cgaatcggcgtggtgatggactcgttctccgccgaggaggtcgaggagatgatcgagccg
gacggcaagatccacgtgacctgcgaatactgctcgcgcgtctacaagctggacccgccg
acggcggggtga

DBGET integrated database retrieval system