KEGG   Caulobacter segnis: Cseg_3113Help
Entry
Cseg_3113         CDS       T01221                                 

Definition
(GenBank) DNA ligase D
  KO
K01971  bifunctional non-homologous end joining protein LigD [EC:6.5.1.1]
Organism
cse  Caulobacter segnis
Pathway
cse03450  Non-homologous end-joining
Brite
KEGG Orthology (KO) [BR:cse00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03450 Non-homologous end-joining
    Cseg_3113
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:cse03400]
    Cseg_3113
Enzymes [BR:cse01000]
 6. Ligases
  6.5  Forming phosphoric-ester bonds
   6.5.1  Ligases that form phosphoric-ester bonds (only sub-subclass identified to date)
    6.5.1.1  DNA ligase (ATP)
     Cseg_3113
DNA repair and recombination proteins [BR:cse03400]
 Prokaryotic Type
  DSBR (double strand breaks repair)
   NHEJ (non-homologous end-joining)
    Two-component NHEJ DNA repair complex
     Cseg_3113
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: LigD_N DNA_ligase_A_M DNA_ligase_A_C
Motif
Other DBs
NCBI-ProteinID: ADG11553
UniProt: D5VM30
LinkDB All DBs
Position
complement(3396725..3399376)
Genome map
AA seq 883 aa AA seqDB search
MAARKLAAYEAKRDFEKTAEPSGAAAVAASERARFVIQKHAATRLHYDLRLEHEGVFLSW
AVTRGPSRDPHDRRLAVHVEDHPLAYGDFEGTIPKGQYGGGTVMLWDRGWWAPEPGFDLQ
KGLKKGEIKLVFAGERMKGGWVLVRINNDKFGDGKRENWLLIKHRDEFAMEGDLDFLEDT
AFSIASGRTMEEIAAGKGKAPTPFMTKKATASDAIWNSKGSPEATAEKAAKETGAPRRRS
AKPSAKAQAPRKVVKKAIAMPDFVPPQLCKLVDRPPGGGDWAHEIKFDGYRMQMRVEGGE
AALRTRAGLDWSGKFPQLIKDGAALPDALIDGEVVALDADGSPSFAGLQAALAEESTDDL
IFFAFDLLYAHGEDLTDLPLSERKARLKALLPEDGDRIRYVEHFESGGEAVLQSACRMSL
EGVVSKKLDAPYRSGKPGTWTKAKCRAGHEVVIGGWTTTGDAFRSLIVGVYRDGDLIHVG
RVGTGYGRDKVARLLPKLKAAERKTSPFSGKGAPRGGANIHWVDPVLVAEIEFAGFTGDG
SVRQASFKGLREDKPAQAVEAEAPAPAEDVELAEPKAAFAMKRSDGKVSVRGVAISNPDK
TLWPDAGDGTPGTKRDLAEYFEAVGDWMLEHIKGRPCSVIRMPDGVDGETFFQRHSGKGV
SALIDEIVVSGDRKPYLVFNTVESLVAAAQWGATELHPWNCRPNEQDVPGRLVFDLDPAP
DVSFDAVVEGAREIRDRLEALGLAPFCKTTGGKGLHVVTPLKPTKVDWDAAKAFAREVCA
QMAADSPDLYLLNMSKKERGGKIFLDYLRNDRMSTAVAPLSPRGRPGAPVSWPVSWTQVR
KGLDPKRFNIRTAPSLLKTLDAWDAYAESERDLEAAIRKLGKD
NT seq 2652 nt NT seq  +upstreamnt  +downstreamnt
atggcggcgcgcaagctcgcggcctacgaggccaagcgcgacttcgaaaagacggccgag
ccctcgggcgcggccgccgtcgcggcgtccgagcgggcgcgcttcgtcatccagaaacac
gccgccacgcgactgcactatgacctgcggctggagcacgagggcgtgttcctgtcgtgg
gccgtgaccagggggccctctcgcgatccgcatgaccgccgcctggcggtgcatgtcgag
gaccatccgctggcctacggcgatttcgagggcacgattcccaaaggccaatacggcggc
ggcacggtgatgctgtgggaccgtggctggtgggcgccggagccaggcttcgaccttcag
aaggggctcaagaaaggcgagatcaaactggtcttcgccggcgagcggatgaagggcggc
tgggtcctggtccgcatcaataacgacaagtttggcgacgggaagcgcgagaactggctt
ctgatcaagcatcgcgacgagttcgcgatggagggcgatctcgactttctggaagacacg
gcgttctcgatcgcctcggggcggacgatggaggagatcgcggcggggaagggcaaggcg
cccactccgttcatgacgaagaaagccaccgcgtccgacgcgatctggaacagcaagggc
tcgcccgaggccaccgccgagaaggcggcgaaggagaccggcgcgcccaggcgacgaagc
gccaagccctcggccaaggcgcaggcgccaaggaaggtcgtcaagaaggcgatcgccatg
cccgacttcgtgccgccgcagctgtgcaagctggtcgaccgcccgccaggcggcggcgac
tgggcgcacgagatcaagttcgacggatacaggatgcagatgcgcgtcgagggcggcgag
gccgcactacgcacgcgcgcgggcctcgactggagcggcaagtttccgcagctcatcaag
gatggggcggcgctgccggacgccctgatcgacggtgaggtcgtggctctggacgccgac
ggatcgccctcgttcgccggcctgcaggcggccctggccgaagagagcaccgacgacctg
atcttcttcgcttttgacttgctctacgcccacggtgaggacctgaccgatctgccgctg
tcggaacgcaaggcgcggctgaaggcgctgcttccggaggacggcgaccggatccgctac
gtcgagcatttcgagagcggtggcgaagcggtgctgcagtcggcttgccgcatgtcgctg
gagggcgtcgtttccaagaagctcgacgcgccgtaccgctccggcaagccggggacctgg
accaaggctaagtgccgggccgggcatgaggtggtgatcggtggctggacaacgaccggc
gacgccttccgctcgctgatcgtcggcgtctatcgtgacggcgacctgatccacgttgga
cgggtcggcacgggctatggtcgggacaaggtcgcccgcctgctgccgaagctgaaagcg
gccgaacgcaagacctcgcccttcagtggcaagggcgcgccgcgcggcggggccaacatc
cactgggtggaccctgtcctggtcgcggagatagagttcgcgggcttcacgggagacggc
tcggtgcgccaggcgtcgttcaagggtctgcgcgaggacaagcccgcccaggcggtcgag
gccgaagcgccagcgccggccgaggacgtcgagctcgccgagcccaaggcggcgttcgcg
atgaagcgaagcgatggcaaggtttcggtgcggggcgtggcgatctccaaccccgacaag
acgctgtggccggacgccggcgatgggacgccggggaccaagcgcgacctcgccgaatat
ttcgaagccgttggcgattggatgctggagcacatcaaggggcggccttgctcggtgatc
cgcatgcccgatggcgtcgacggcgagacctttttccagcgccattccggaaagggcgtc
tcggccctgatcgacgagattgtcgtcagcggcgaccgcaagccctacctcgtcttcaac
accgttgagagcctggtggcggccgcccaatggggcgccacggaactacatccatggaac
tgccggccgaacgaacaagacgttcctggccgcctggtcttcgacctggatcccgcgccc
gatgtgtccttcgacgccgtggtcgagggcgcgcgagagatccgcgatcggcttgaggcg
ctgggcttggcgcccttctgcaagacgaccggcggcaagggcctgcacgtcgtcacaccg
ctgaagccgacgaaagtggattgggacgccgccaaggccttcgcccgagaggtctgcgcg
cagatggccgccgacagtccagacctctatctgctgaacatgtccaagaaggagcgcggc
gggaagatcttcctcgactacctgcgcaacgaccgcatgagcacggcggtggcgccgctg
tcgccgcgcggccgccccggcgcgccggtgtcctggcccgtgtcctggacccaggtgcgc
aaaggcctcgaccccaagcgtttcaacatccgcaccgcgccgagcctgctgaagactctc
gacgcctgggacgcctatgcggaaagcgagcgcgacctggaggcggcgatcaggaagctc
ggcaaggactag

DBGET integrated database retrieval system