KEGG   Cynoglossus semilaevis (tongue sole): 103376625
Entry
103376625         CDS       T04866                                 

Gene name
map2k2
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 2
  KO
K04369  mitogen-activated protein kinase kinase 2 [EC:2.7.12.2]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04270  Vascular smooth muscle contraction
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04540  Gap junction
csem04620  Toll-like receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04916  Melanogenesis
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103376625 (map2k2)
   04012 ErbB signaling pathway
    103376625 (map2k2)
   04370 VEGF signaling pathway
    103376625 (map2k2)
   04371 Apelin signaling pathway
    103376625 (map2k2)
   04068 FoxO signaling pathway
    103376625 (map2k2)
   04150 mTOR signaling pathway
    103376625 (map2k2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103376625 (map2k2)
  09143 Cell growth and death
   04210 Apoptosis
    103376625 (map2k2)
   04218 Cellular senescence
    103376625 (map2k2)
  09144 Cellular community - eukaryotes
   04540 Gap junction
    103376625 (map2k2)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103376625 (map2k2)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103376625 (map2k2)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103376625 (map2k2)
   04912 GnRH signaling pathway
    103376625 (map2k2)
   04916 Melanogenesis
    103376625 (map2k2)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103376625 (map2k2)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103376625 (map2k2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103376625 (map2k2)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103376625 (map2k2)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: STE group
  STE7 family
   103376625 (map2k2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like APH Seadorna_VP7 Kdo
Other DBs
NCBI-GeneID: 103376625
NCBI-ProteinID: XP_016886450
UniProt: A0A3P8V0N5
LinkDB
Position
2
AA seq 399 aa
MAPKKRPVPLNITPSGEGQAPSNTNDAASEANLEALQKKLGELEMDDQQRKRLDAFFNQK
AQVGELKDEDFEPICELGAGNGGVVSKVCHKPSVLIMARKLIHLEIKPAIRNQIIRELQV
LHECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQVLKEARRIPEQILGKVSIAVLRGL
AYLREKHQIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQG
THYSVQSDVWSMGLSLVELAIGRYPIPPPDAKELEAIFGKAVLDGSEAEPQTNVQRPRPP
GRPVSGHGMDSRPAMAIFELLDYIVNEPPPKLPHGVFSNDFQDFVTKCLIKNPAERADLK
MLMSHTFIKRSEVDEVDFAGWLCKTMGLKQPSTPTRSTE
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggctcccaaaaaaagacccgtgcccctgaacataacccccagtggggagggacaggcc
ccctccaacacaaatgatgctgcatcagaagccaacctcgaggccttacagaagaaacta
ggtgagctggaaatggacgaccaacagagaaaacgactggacgccttcttcaaccagaag
gctcaggttggagagttgaaggatgaggactttgagcccatatgcgagttgggagcgggt
aacggaggagtggttagcaaggtctgccacaaaccctcggttttgatcatggcccgcaag
ttgatccacctggaaatcaagcctgccatcaggaaccagattatcagagagctacaggtg
ctgcatgaatgcaactccccttacattgtgggcttctacggagctttttatagcgatgga
gagatcagcatctgtatggagcacatggatggtggatcgttggaccaagtcctgaaggaa
gccagaagaatcccagaacaaatcctaggaaaagttagcatagctgtgttgcgtgggtta
gcctacctgcgagagaagcaccagatcatgcacagagatgtcaagccctccaacattctt
gtcaactctcgcggggagatcaagctgtgcgactttggtgtaagcggccagctcatagat
tccatggccaactcctttgttggaacgcgctcctacatgtcgccggagagactgcagggc
actcactactctgttcagtctgatgtgtggagcatgggcctgtccttagtggagctggca
atcggccgctaccccattcccccgccagacgccaaagaactggaggccatctttggaaaa
gctgttttagatggtagtgaggctgagcctcaaaccaatgtgcaaaggccaagacctcca
ggcagacctgtgagcggacacgggatggacagtagacctgctatggccatctttgaactt
ttggactacattgtaaatgagccaccgccgaaactgccacacggtgtcttttccaatgac
ttccaagactttgtgacaaagtgtttgataaaaaatccagccgagagagcggacctcaag
atgctaatgagtcatacgttcatcaaacgatcagaagtggacgaggtcgactttgcaggc
tggttgtgtaaaaccatggggctcaaacagcccagcactcccacccgcagcacggagtga

KEGG   Cynoglossus semilaevis (tongue sole): 103380238
Entry
103380238         CDS       T04866                                 

Gene name
map2k1
Definition
(RefSeq) dual specificity mitogen-activated protein kinase kinase 1
  KO
K04368  mitogen-activated protein kinase kinase 1 [EC:2.7.12.2]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04114  Oocyte meiosis
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04270  Vascular smooth muscle contraction
csem04370  VEGF signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04540  Gap junction
csem04620  Toll-like receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04912  GnRH signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem04916  Melanogenesis
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103380238 (map2k1)
   04012 ErbB signaling pathway
    103380238 (map2k1)
   04370 VEGF signaling pathway
    103380238 (map2k1)
   04371 Apelin signaling pathway
    103380238 (map2k1)
   04068 FoxO signaling pathway
    103380238 (map2k1)
   04150 mTOR signaling pathway
    103380238 (map2k1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103380238 (map2k1)
  09143 Cell growth and death
   04114 Oocyte meiosis
    103380238 (map2k1)
   04210 Apoptosis
    103380238 (map2k1)
   04218 Cellular senescence
    103380238 (map2k1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103380238 (map2k1)
   04540 Gap junction
    103380238 (map2k1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103380238 (map2k1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103380238 (map2k1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103380238 (map2k1)
   04912 GnRH signaling pathway
    103380238 (map2k1)
   04914 Progesterone-mediated oocyte maturation
    103380238 (map2k1)
   04916 Melanogenesis
    103380238 (map2k1)
  09153 Circulatory system
   04270 Vascular smooth muscle contraction
    103380238 (map2k1)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103380238 (map2k1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103380238 (map2k1)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.12  Dual-specificity kinases (those acting on Ser/Thr and Tyr residues)
    2.7.12.2  mitogen-activated protein kinase kinase
     103380238 (map2k1)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: STE group
  STE7 family
   103380238 (map2k1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr Pkinase_fungal Kinase-like Seadorna_VP7 NAD_binding_6
Other DBs
NCBI-GeneID: 103380238
NCBI-ProteinID: XP_008310311
UniProt: A0A3P8VBW5
LinkDB
Position
6
AA seq 395 aa
MQKRRKPEPIQLNPIPDGNAINGTGATETNLEALQKKLEELELDEQQRIRLEAFLTQKQK
VGELKDDDFEKICELGAGNGGVVFKVSHRPSGLIMARKLIHLEIKPAIRNQIIRELQVLH
ECNSPYIVGFYGAFYSDGEISICMEHMDGGSLDQSLKKAGKIPEQILGKVSIAVIKGLSY
LREKHKIMHRDVKPSNILVNSRGEIKLCDFGVSGQLIDSMANSFVGTRSYMSPERLQGTH
YSVQSDIWSMGLSLVEMAIGRFPIPPPDAKELEKIFGCPMEGDAASSDVSPKPRPPGRPS
STYGPDSRPPMAIFELLDYIVNEPPPKLPGIFSPEFQDFVNKCLIKNPAERADLKQLMVH
NFIRQSEAEQVDFAGWLCSTIGLNKPGTPTHGNAI
NT seq 1188 nt   +upstreamnt  +downstreamnt
atgcagaaaagaaggaagccagagcccatccaactcaacccgataccggacggaaacgcc
atcaacggtaccggagccacagaaacaaacttggaggcgctgcagaaaaagctggaggag
ctggaattagatgagcagcagcgaatccgcctggaagcctttttgacccagaagcagaag
gtgggagagctgaaggacgatgactttgagaagatctgtgagctgggcgcaggcaacgga
ggggtggtcttcaaggtctcccataggccctcgggtctgattatggcgaggaagctgatt
cacctggagatcaagcctgccatcaggaaccagatcatcagagagctgcaggtgcttcac
gagtgtaactccccctacattgtgggtttttacggagctttctacagtgatggagaaatc
agcatctgcatggagcacatggatggtggctccctggatcagtcgctgaagaaagcaggc
aagatcccagagcagatccttggcaaagtcagcattgctgtcattaaaggactttcctac
ctgagggagaaacacaagatcatgcacagagacgtcaagccgtccaacatcctcgtgaat
tcccgaggtgagattaagctgtgtgactttggagtgagtgggcagctcatcgactccatg
gccaactcctttgtgggcacacgctcgtacatgtctcctgagcgtttgcagggcactcat
tactctgttcagtcagacatctggagcatgggcctgtccctggttgaaatggccattggt
cgcttcccaattccaccacctgatgctaaagaactagaaaagattttcggctgtccaatg
gagggagacgctgcctcgagtgatgtctcccccaaaccaaggcctcctggacgaccaagc
agcacatacggcccagacagcagaccaccaatggctatatttgaactgcttgattatatt
gtaaatgagcctccacctaaactacctgggatatttagccccgagttccaagactttgtg
aacaagtgtttgattaaaaacccagcagagagggccgacctcaaacagttaatggttcac
aattttatcaggcagtcagaggcagagcaggtggactttgctggctggttgtgcagcacc
atcggtcttaataagcctgggacacccacccacggaaatgcaatctaa

DBGET integrated database retrieval system