KEGG   Cynoglossus semilaevis (tongue sole): 103376655
Entry
103376655         CDS       T04866                                 

Gene name
prkaa2
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-2
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103376655 (prkaa2)
   04068 FoxO signaling pathway
    103376655 (prkaa2)
   04150 mTOR signaling pathway
    103376655 (prkaa2)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103376655 (prkaa2)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103376655 (prkaa2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103376655 (prkaa2)
   04920 Adipocytokine signaling pathway
    103376655 (prkaa2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103376655 (prkaa2)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103376655 (prkaa2)
   03029 Mitochondrial biogenesis [BR:csem03029]
    103376655 (prkaa2)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103376655 (prkaa2)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103376655 (prkaa2)
Membrane trafficking [BR:csem04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103376655 (prkaa2)
Mitochondrial biogenesis [BR:csem03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103376655 (prkaa2)
  Mitophagy factors
   Other mitophagy factors
    103376655 (prkaa2)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH YukC
Other DBs
NCBI-GeneID: 103376655
NCBI-ProteinID: XP_016896024
LinkDB
Position
2
AA seq 532 aa
MSNSFTKPHICRLCVGEHQLTGHKVAVKILNRQKIRSLDVVGKIKREIQNLKLFRHPHII
KLYQVISTPTDFFMVMEYVSGGELFDYICKHGRVEDTEARRLFQQIISAVDYCHRHMVVH
RDLKPENVLLDANRNAKIADFGLSNMMSDGEFLRTSCGSPNYAAPEVISGRLYAGPEVDI
WSCGVILYALLCGTLPFDDEHVPTLFKKIRGGVFYIPEYLTRSVASLLMHMLQVDPLKRA
TIKDIREHEWFRQDLPCYLFPEDPSYDATVVDEEAVKEVCEKFECTEPEVISSLYSGDPQ
DQLAVAYHLIIDNRRIMTQASEFYLASSPPQGSFIEEGMPLPPGVKPHPERMPPLLADSP
KSRCPLDALNTTRPKPLAVKKAKWHLGIRSQSRPYDIMAEVYRAMKQLNFDWKVVNPYYL
RVRRKNPVTGNLVKMSLQLYQVDNRSYLLDFKSIDVGFKSGSSTPQRSGSTAGLHRPRLS
IDSASPAIDLPQLSSSLPGSLSGSTPILTPRQGSHTMDFFEMCASLITTLAR
NT seq 1599 nt   +upstreamnt  +downstreamnt
atgtcaaattctttcaccaaacctcatatttgtagattatgtgttggagagcatcagctg
acaggccataaagtggctgtaaagatcctaaacagacagaagatccgcagtctggatgtt
gtcgggaagatcaaacgagagattcagaacctcaaactgttcagacacccgcacatcatc
aagctgtatcaggtgataagtacaccgacagatttcttcatggttatggaatacgtgtca
ggaggtgaactattcgactacatatgcaagcatggacgggtagaggacactgaagctcgc
cgtcttttccagcaaatcatctcagctgtagactactgccacaggcacatggtggttcac
agagacctcaaacctgaaaatgtcctgctggatgccaataggaatgccaagattgcagat
tttggtctgtcaaacatgatgtcagatggtgagtttttgcggaccagctgtggctcacca
aactatgcagctccagaggtcatctcaggaaggctgtatgcaggcccagaggtggacatc
tggagctgtggtgtgatcctgtacgctctgctctgtgggactctgccttttgatgatgag
catgtccccacactctttaaaaagattagagggggcgtcttttacatcccagagtacctg
acccgttctgtggcttcgctgctgatgcacatgctacaggtggacccccttaagagagcc
accatcaaagatatcagggaacatgaatggtttaggcaggacctgccgtgttacctgttc
cctgaggacccttcgtatgacgctacagtggtggatgaggaagcagtcaaagaagtgtgt
gagaagtttgagtgcaccgagcctgaggtcatctccagtctttacagtggagatccacag
gatcagttagcagtggcctatcaccttatcatagacaaccgacgcatcatgacccaggcc
agtgagttctacttggcctccagtccgccccagggttcatttatagaggaaggaatgcca
ctgccccctggggtaaaaccccacccagaaaggatgccaccactcctggcagatagccct
aaatcacggtgtcccctggatgctctaaacaccacccgacccaaacctctggcagtgaaa
aaggccaagtggcatctgggtataaggagtcagagcagaccctatgacatcatggctgaa
gtgtacagggctatgaaacagctcaattttgactggaaggtggtgaatccatactatctt
cgagtgcgaaggaagaatccggtgacgggaaacctggtgaaaatgagccttcaactctat
caggtagacaacagatcgtacctcctggacttcaagagcatcgacgtaggcttcaagtcg
ggttcgtccactccacagaggtcaggctccacagctggacttcacaggccaaggctgagc
atcgactcggcgagtcctgccattgatcttcctcagctcagctcctctctcccaggatcc
ctgtctggtagcacccccatactcactccacgtcagggatcacacaccatggacttcttt
gaaatgtgtgccagtctgatcactactcttgcacgctga

KEGG   Cynoglossus semilaevis (tongue sole): 103377345
Entry
103377345         CDS       T04866                                 

Gene name
prkag2
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-2
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103377345 (prkag2)
   04068 FoxO signaling pathway
    103377345 (prkag2)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103377345 (prkag2)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103377345 (prkag2)
   04920 Adipocytokine signaling pathway
    103377345 (prkag2)
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 103377345
NCBI-ProteinID: XP_016886910
LinkDB
Position
3
AA seq 505 aa
MTEQPDPDDAVSESERDIYMRFMKCHKCYDIIPTSSKLVVFDTTLQVKKAFFALVANGVR
AAPLWESKKQSFVGMLTITDFINILTRYYKSPMVQIYELEEHKIETWRELYLQETFKPLV
NITPDASIFDAVYSLIKNKIHRLPVIDPVSGNALYILTHKRILKFLQLFLCEMPMPAFMK
QTLEVLGVGTYANIAFIHPDTPLITALSVFTHRRVSALPVVDHNGKVVDIYSKFDVINLA
AEKTYNNLDLTVTQALRHRCQYFEGVVKCNKIETLETIVDRIVKAEVHRLVVVDEGSRII
GIVSLSDILQTLVLTPAGLGRKESLPSQPIDPQNRLDQDQDQNQAQALKPGEDQEQDQVQ
DLDHEVSSETDVKHEPNTEQNQELGQEQTPVQNDDLDLEQGQDQEEETHHQELDQEVVKI
QDQTSCEDTEPDCGNTDAAETCLQGAEEEEETKEEEEEVKEEEINEEVEGDKEEEGEAKE
EEEAAKEEEAINEELEGGGGVVYVA
NT seq 1518 nt   +upstreamnt  +downstreamnt
atgacggagcagccggaccccgacgatgctgtgtcagagtcagagagagacatctacatg
cgtttcatgaagtgtcataagtgctatgacatcatcccaaccagctccaaactggtggtg
tttgacaccacgctgcaggtgaaaaaagcattttttgcactggtggccaatggagtgaga
gctgctccactgtgggagagcaagaaacagagcttcgtaggaatgttgaccatcacagat
ttcattaacatcctgaccagatactacaaatcccctatggtacagatctacgagctggag
gaacacaagatcgagacgtggcgagaactttacctacaagaaacatttaagcctctggtc
aacattacacctgatgccagcatctttgacgccgtttactcactgatcaagaacaagatc
catcgtctgcccgtcatcgacccggtgagcggcaacgccctctacatcctgacccacaag
aggatcctcaagttcctccagctctttctttgtgagatgcccatgccggccttcatgaag
cagacgttggaggtcctgggcgtgggcacgtacgccaacatcgccttcatccaccctgac
acaccacttatcaccgcactgtcagtcttcacacaccgcagagtctccgccctgcctgtc
gtcgatcacaacggtaaagtggtggacatctactccaagtttgacgtcattaacttggca
gcagagaaaacctacaataacttggatctgacggtgactcaggcgctcagacacagatgt
cagtactttgaaggagtcgtaaagtgtaacaagattgagacactggagaccattgtggac
cgcatcgtcaaagccgaggttcacagactggtggtggttgatgaaggctctcgtatcatc
ggcatcgtctcactgtcagacattcttcaaacgctggtcttaactcctgcaggtctcggg
aggaaggagtctctgccaagtcaacccatagatccacagaacagactggaccaggaccag
gaccaaaaccaggctcaagccctgaaaccaggtgaagaccaagagcaagatcaggtgcag
gacttggaccacgaggtctcttcagagacggacgtcaaacatgaaccaaatacggagcag
aaccaagaactgggtcaggaacagaccccagttcagaatgacgacctggatctggagcag
ggtcaagaccaggaggaggaaactcatcatcaggaattggaccaagaagtggtcaagatc
caggatcagacgtcctgtgaagacaccgaaccagactgtgggaacactgatgctgcagag
acctgccttcaaggagcagaggaggaggaggagacaaaggaagaggaggaagaagtgaag
gaggaggagataaatgaagaagtagagggagataaggaagaggagggagaggcgaaggaa
gaggaagaagcagcgaaggaagaggaggcgataaatgaagaactagagggaggtgggggc
gtggtttatgttgcttaa

KEGG   Cynoglossus semilaevis (tongue sole): 103385952
Entry
103385952         CDS       T04866                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103385952
   04068 FoxO signaling pathway
    103385952
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103385952
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103385952
   04920 Adipocytokine signaling pathway
    103385952
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 103385952
NCBI-ProteinID: XP_008318212
UniProt: A0A3P8UQJ4
LinkDB
Position
11
AA seq 330 aa
MECIPLSVEDFEVKKDPVIEDPEHNVYTRFMKSHKCYDLVPTSSKLVVFDTSLQVKKAFF
ALVSNGVRAAPLWDSKKQCFVGMLTITDFINILHRYYKSPLVQIYELEEHKIETWREVYL
QDSFKPLVSISPSASLYDAVSSLLRNKIHRLPVIDPLTGNTLYILTHKRILKFLKLFISE
MPKPSFLRQTLEELNIGTFKNIAVVRSDTPLYTALGIFVEQRVSALPVVDDKGRVVDIYS
KFDVINLAAEKTYNNLDITVTKALQHRSQYFEGVLTCHRNETLEAIINRLVEAEVHRLVV
VDEQDVVKGIVSLSDILQALVLTDGDEGTA
NT seq 993 nt   +upstreamnt  +downstreamnt
atggagtgtataccactatctgtggaagattttgaggtcaaaaaggacccagttatcgaa
gacccagagcacaatgtctacaccaggttcatgaagtcccacaagtgttatgacctggtt
cctaccagctccaaattggttgtgtttgatacatcacttcaggtgaaaaaggcattcttt
gcacttgtttctaatggggtgagggcagcgcctctgtgggacagtaagaagcagtgcttt
gttggcatgctaaccatcacagacttcatcaacattctccatcgctattacaaatctcca
ctggtccaaatatatgagttggaagaacacaaaattgaaacatggagagaggtttatctc
caagactccttcaaacccttggtgagcatatcccccagtgcaagtttgtacgacgcagtg
tcgtctctgctgaggaacaagatccacagattgcctgtaatcgacccgctgacgggaaac
acactctacatcctgacacacaagaggattctcaagttcctgaagctttttatctcagag
atgccaaaaccttctttcctgagacaaacgttggaggagctgaacataggaacctttaag
aacatagcagtcgtccgctcagacacgccgctctacacagcgctgggtattttcgttgag
cagcgagtgtcggcgcttcctgtcgtggacgacaaaggacgagtggtggatatttactcc
aaatttgatgtgataaacctggcagcagagaagacctacaacaacctggacatcaccgtg
accaaggcgttacagcaccgctcccagtactttgaaggagttctcacctgccacagaaac
gaaaccctggaggccatcatcaacagactggtggaggccgaggttcacaggctggtggtg
gtggatgagcaggacgtggtgaagggaatcgtctccctctctgatatcctgcaggcactg
gtgctgacagatggagatgaaggcactgcttga

KEGG   Cynoglossus semilaevis (tongue sole): 103389875
Entry
103389875         CDS       T04866                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-1-like isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103389875
   04068 FoxO signaling pathway
    103389875
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103389875
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103389875
   04920 Adipocytokine signaling pathway
    103389875
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 103389875
NCBI-ProteinID: XP_008323703
LinkDB
Position
14
AA seq 336 aa
MEPSSPVWISKEKMEIQRQEADGTVYMNFMKSHCCYDAIPTSCKLVIFDTKLQVKKAFFA
LVANSLRAAPLWDSNMQRFVGKLTITDFINILHCYYKSPMVQMYELESHKIETWRGDSFP
NIHLQYSSRFLISISPQASLFDAIYSLLKYKIHRLPVIDPESGNVLHILTHKRILKFLYI
FGKKIPKPAFIRTPIKDLGIGTFRNIATVQETASLYEALSIFVERRVSALPVVNEQGKVV
ALYSRFDVINLAAQKTYNNLDITMQEAISRRTCYVEGVIKCYPHESLEIIIDRIVGAKVH
RLVLVDRADVVRGIISLSDLLQAMVLTPAGIDALFS
NT seq 1011 nt   +upstreamnt  +downstreamnt
atggaaccttcttcaccggtatggatctcaaaagagaagatggaaatacagaggcaagag
gctgacggcaccgtctacatgaacttcatgaagagtcactgctgctacgatgccattcca
accagctgcaaactggtcatatttgataccaaactgcaagtaaaaaaggccttctttgct
ttggtggcaaacagcctgagagcagcgccactgtgggacagcaacatgcaaagatttgtg
gggaagctgaccattacagatttcatcaacatcctccactgctattacaagtctcccatg
gttcaaatgtatgaactggagagtcacaagatcgaaacatggagaggtgattcattccca
aacatccacctacaatattccagtcgcttcctcattagtatttctccacaggccagcctg
tttgatgccatttattccttactcaaatataagatccacagacttcctgtcatcgatccg
gaatctgggaatgtcctgcacattctgacccacaaacgaatcctcaagtttctatatata
tttgggaaaaaaattcccaagcctgcctttattcggacacccattaaagacctcgggatc
ggaacattcaggaacattgccacggtccaagaaacggcatcactttatgaagcgctctcc
atatttgtggaaaggcgtgtgtcagcactgcctgtggtgaatgaacagggtaaagtggtg
gcgctgtactcaagatttgacgtgattaatctggcagcccagaagacttacaacaatctg
gacatcactatgcaggaagccatcagcaggcgtacgtgttatgttgagggagtcatcaag
tgctacccccatgaatctctggaaattattatagatcggattgtcggcgctaaggtccat
cgactggttctggtggacagggctgatgtggtgaggggcatcatctctctgtctgacctc
ctgcaggccatggtcctaactcctgcaggtattgatgcgcttttctcctag

KEGG   Cynoglossus semilaevis (tongue sole): 103390073
Entry
103390073         CDS       T04866                                 

Gene name
prkaa1
Definition
(RefSeq) 5'-AMP-activated protein kinase catalytic subunit alpha-1
  KO
K07198  5'-AMP-activated protein kinase, catalytic alpha subunit [EC:2.7.11.11]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103390073 (prkaa1)
   04068 FoxO signaling pathway
    103390073 (prkaa1)
   04150 mTOR signaling pathway
    103390073 (prkaa1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103390073 (prkaa1)
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103390073 (prkaa1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103390073 (prkaa1)
   04920 Adipocytokine signaling pathway
    103390073 (prkaa1)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103390073 (prkaa1)
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103390073 (prkaa1)
   03029 Mitochondrial biogenesis [BR:csem03029]
    103390073 (prkaa1)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.11  Protein-serine/threonine kinases
    2.7.11.11  cAMP-dependent protein kinase
     103390073 (prkaa1)
Protein kinases [BR:csem01001]
 Serine/threonine kinases: CAMK group
  CAMKL family
   103390073 (prkaa1)
Membrane trafficking [BR:csem04131]
 Autophagy
  Other autophagy associated proteins
   Others
    103390073 (prkaa1)
Mitochondrial biogenesis [BR:csem03029]
 Mitochondrial quality control factors
  Regulator of mitochondrial biogenesis
   Other regulator of mitochondrial biogenesis
    103390073 (prkaa1)
  Mitophagy factors
   Other mitophagy factors
    103390073 (prkaa1)
SSDB
Motif
Pfam: Pkinase PK_Tyr_Ser-Thr AdenylateSensor Kinase-like RIO1 Kdo APH YukC
Other DBs
NCBI-GeneID: 103390073
NCBI-ProteinID: XP_008324003
UniProt: A0A3P8WCG7
LinkDB
Position
14
AA seq 574 aa
MATEKTKHEGRVKIGHYILGDTLGVGTFGKVKVGQHELTKHQVAVKILNRQKIRSLDVVG
KIRREIQNLKLFRHPHIIKLYQVISTPTDIFMVMEYVSGGELFDYICKNGKLDEKESRRL
FQQIISAVDYCHRHMVVHRDLKPENVLLDAHMNAKIADFGLSNMMSDGEFLRTSCGSPNY
AAPEVISGRLYAGPEVDIWSSGVILYALLCGTLPFDDDHVPTLFKKICDGIFFTPQYLNP
SVISLLKHMLQVDPMKRATIKEIREDEWFKQDLPKYLFPEDPSYSNNMIDDEALKEVCEK
FECTEEEVLSCIYSRNHQDPLAVAYHLIIDNRRIMSEAKDFYLASSPPDSFLDDQHLTSS
GAAVAGFIKPHPERVPFLVAETPPRPRHTLDELNPQKSKHQGVRRAKWHLGIRSQSRPND
IMSEVCRAMKQLDYEWKVVNPYYLRVRRKNPITGMQTKMSLQLYQVDSRTYLLDFRSIDD
DMLEVKFGTATPLRSGSVGNYRTTVKGDADGGDASPMSGSSTLPPKAAEGSLASSLTSSI
DSTGGGDNGTVPRPGSHTIEFFEMCANLIKLLAR
NT seq 1725 nt   +upstreamnt  +downstreamnt
atggcgacggaaaaaaccaaacacgaaggcagagttaaaattggacattacattctcgga
gacacgctcggagttgggacttttggaaaggtcaaagtgggccaacatgagctgaccaag
caccaagtggcagtgaagatcctgaaccggcaaaagatccgcagtttggatgtggtggga
aagatccgcagggagattcagaacctcaagctcttcaggcatcctcacataattaaactg
tatcaggtcattagcacccctacagatatcttcatggtgatggaatatgtctcaggggga
gagctctttgattatatctgcaaaaatggaaagttggatgaaaaggagagtcgtcggctg
ttccagcagattatatcggcggtcgactactgccaccggcacatggtggtgcaccgagac
ctaaagcctgaaaatgtgctgcttgatgctcacatgaatgccaagatcgcagactttggt
ttatctaacatgatgtcagatggagagttcctgcgaacaagctgcggttctccaaattat
gctgctcctgaggtcatctcaggaaggttatatgctggaccagaggtggacatttggagc
agtggtgtcattctctacgccttgttgtgtggaacacttccgtttgatgacgaccatgtg
ccaacactgtttaagaagatctgtgatgggatttttttcacaccgcagtatcttaatcct
tcagtaattagcctcctcaaacacatgctacaggtggaccccatgaaacgagccaccatt
aaagaaatcagagaggatgagtggttcaaacaggacctgcctaagtacttgttccccgag
gacccttcttacagcaacaacatgatcgatgacgaggcgttgaaggaggtctgtgagaag
tttgagtgcactgaagaggaggtgctgagctgcatctacagtcgcaaccatcaggatccg
ctggccgtcgcctatcacctcattattgacaatcgacgcattatgagtgaagccaaggac
ttctacctggcatccagccctccggactctttcctggacgaccagcacctgacttcgtcc
ggtgcagccgtagctggttttatcaagccccaccctgagcgcgtaccattccttgtggcg
gaaacaccgcccaggcctcggcacactctggatgaattaaacccccagaagtccaaacac
cagggtgtcaggcgggcaaagtggcacctgggaattcgcagtcagagtagacccaatgat
atcatgtcagaggtgtgccgtgccatgaaacagcttgactacgagtggaaggtggtgaat
ccatattatttacgtgtgcgaaggaagaatcctataactgggatgcaaaccaaaatgagc
ctccaactttatcaagtggacagtagaacctacctcctagacttccgtagcatagatgat
gatatgttggaagtaaaatttggaacggccacacctctccgctcgggctccgtgggaaac
taccgcacaactgttaagggtgacgctgatggtggtgatgcttcacccatgtctggcagc
agcactcttccccccaaggcagcagaaggctccttagcctcatcattgacttcctccatc
gactctactggcgggggagacaacggcactgtccctcgcccggggagccacaccatcgag
ttctttgagatgtgcgcaaaccttattaaactacttgcacgataa

KEGG   Cynoglossus semilaevis (tongue sole): 103390344
Entry
103390344         CDS       T04866                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103390344
   04068 FoxO signaling pathway
    103390344
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103390344
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103390344
   04920 Adipocytokine signaling pathway
    103390344
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 103390344
NCBI-ProteinID: XP_008324386
UniProt: A0A3P8X3X3
LinkDB
Position
14
AA seq 268 aa
MGNTSSERSALGQEKAQRRDSRSIKEGERPKILMDSPEDADIFHSEDIKAPLEKEEFLAW
QQDLEAEDKGLTLDRPTVFRWTGDGKEVYLSGSFNNWVNKIPLIRSQNTFVAIVDLPEGE
HQYKFYVDGQWTHDPTEPIVTSQLGTVNNVIQVKKTDFEVFDALMVDSQKCSDMSDLSSS
PPGPYHQDAYAPKQEEKFKSPPILPPHLLQVILNKDTGISCDPALLPEPNHVMLNHLYAL
SIKDGVMVLSGTHRYKKKYVTTLLYKPI
NT seq 807 nt   +upstreamnt  +downstreamnt
atggggaatacaagcagtgagaggtctgcgctgggccaggagaaggctcagcggagagac
agccggagtatcaaggagggagagaggccaaagattctcatggatagtcccgaagatgca
gatatttttcatagtgaagatatcaaagctccgttagaaaaagaggagttcctcgcatgg
cagcaagacttagaagcagaggacaaagggctgaccctagaccgacccacagtctttcgc
tggactggtgatggcaaggaggtttacctctctgggtccttcaacaactgggtcaacaag
attcctcttattcgaagccagaacacttttgtggccatcgtggatctgccagagggggag
catcagtacaagttctacgtggacggacaatggacgcatgatccaacagagccaattgtc
accagccagctgggcaccgtcaacaatgtcatccaggtgaaaaaaacagacttcgaggtg
tttgatgctctgatggtggactcacagaaatgctcagacatgtcagacctctccagctct
cctcctggtccttaccatcaggatgcctacgctcccaagcaggaggagaagttcaagtcc
ccgcctattctcccaccacatctgctgcaggtcatcctcaacaaagacactggcatttct
tgtgaccctgcgttacttcctgaacccaaccacgtgatgctcaaccacctgtacgctctt
tccatcaaggatggcgtgatggtgctgagcggcacacaccgctacaagaagaagtacgtc
accaccttgctatacaaacccatctga

KEGG   Cynoglossus semilaevis (tongue sole): 103391741
Entry
103391741         CDS       T04866                                 

Gene name
prkag3
Definition
(RefSeq) 5'-AMP-activated protein kinase subunit gamma-3 isoform X1
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103391741 (prkag3)
   04068 FoxO signaling pathway
    103391741 (prkag3)
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103391741 (prkag3)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103391741 (prkag3)
   04920 Adipocytokine signaling pathway
    103391741 (prkag3)
SSDB
Motif
Pfam: CBS Cbl_N3
Other DBs
NCBI-GeneID: 103391741
NCBI-ProteinID: XP_008326353
LinkDB
Position
16
AA seq 386 aa
MTVWFHGGRRPAPDMEPLPEIPLFELDDEEDKVENIHSEYGSCRYAAYPIAPPADQDPDT
FVYMNFMKTHHCYDTIPTSSKLVIFDTTLQVKKAFFALVANGVRAAPLWDSKLQCFVGML
TITDFINILHRYYKSPLVQIYELEEHKIETWREIYLQYSVNRLISITPESSLFDAIYSLL
KNKIHRLPVIDPVSGNVLHILTHKRILKFLHIFGSKIPKPRFLQKRISEVAIGTFREIAT
VQESASVYEALSIFVERRVSALPVVNDQGKVVALYSRFDVINLAAQKNYNNLNMTMHEAV
ASRACCLEGVLKCYPYETLEIIIDRIAKAEVHRLVLVDKDDVVRGIVSLSDLLQALILTP
AVSLQVVAPSNCKISSEMCHQHHVQH
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgacagtctggttccacggaggcagacgtcctgctccagacatggagcctcttcctgaa
attcctttatttgaattggatgatgaagaggacaaagtggaaaatattcactcagaatat
ggcagctgcagatatgcagcataccccattgcgccccctgcagatcaggatcctgacacg
tttgtgtatatgaactttatgaagactcaccattgctatgacaccatccctaccagctcc
aaactggtcatctttgacacaacactacaggttaagaaggctttcttcgctctggtggct
aatggtgtgagggcggcaccactgtgggacagcaaactccagtgttttgtggggatgctg
actattactgacttcatcaacattctccatcgatactacaagtctcctctggttcagatc
tatgagctggaagaacataagatagaaacatggcgagaaatttatctccaatactcagtg
aacagactgatcagtatcaccccagagtccagtctgtttgatgccatttactccctgctg
aagaataagatccaccggctgccggtcatcgacccagtgtcagggaacgtcctccacatc
cttactcacaaacgcatcctcaaattcctccacatttttggatctaaaattcctaaaccc
aggttccttcaaaagcgtatcagcgaagtggcgattggtaccttcagagagattgcaacg
gtccaggaatcagcctcagtctatgaagctttgtcaatttttgtagagagaagagtatca
gccttgcctgtggtcaatgaccaaggtaaagtggtggctctctactcacggtttgatgtc
attaatcttgcagcccagaaaaactacaacaacctgaacatgacgatgcacgaagctgtc
gcctccagagcttgttgcctggaaggagtcctgaagtgttacccttacgaaacactggag
attattattgaccggattgcaaaagcagaggtgcatcgattagtcttggttgacaaagac
gatgtggtgaggggcattgtttccttatctgacctcctacaagctctgatccttactcct
gcagtgtctcttcaagtagttgctccttcaaactgcaagatctcctctgagatgtgccac
caacaccatgttcaacactaa

KEGG   Cynoglossus semilaevis (tongue sole): 103395985
Entry
103395985         CDS       T04866                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-2
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103395985
   04068 FoxO signaling pathway
    103395985
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103395985
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103395985
   04920 Adipocytokine signaling pathway
    103395985
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 DUF4758
Other DBs
NCBI-GeneID: 103395985
NCBI-ProteinID: XP_008332089
UniProt: A0A3P8WDF1
LinkDB
Position
20
AA seq 269 aa
MGNTSERASADRHGAKAQRSDSSGSHKDQEPSSKMVDSTDDPNIFNTHGPETSKASGEKE
FTPDMEDLVKTGPQARPTVIRWAGGGKEVYIAGSFNNWSTKIPLNKSHNDFVAILDLPEG
EHQYKFFVDGQWVHDASEPVVTSQLGTINNLIHVKKSDFEVFDALHVDSLECSDSSDLSS
SPPGPYGQEQYIFRPEERFKAPPILPPHLLQVILNKDTNISCDPALLPEPNHVMLNHLYA
LSIKDGVMVLSATHRYKKKYVTSLLYKPI
NT seq 810 nt   +upstreamnt  +downstreamnt
atgggcaacactagtgagagagcatctgcagaccgccatggagccaaagcccagcgttca
gacagcagtggcagtcacaaagaccaggaacccagcagtaagatggtggacagcaccgat
gaccccaacattttcaacacgcacggaccagagacgtccaaggcatctggagagaaagaa
ttcaccccagatatggaggacctggtgaagactggccctcaggctcgacccactgtgatc
agatgggcgggtggagggaaggaggtgtacatcgctggttcctttaacaactggagcaca
aagataccgctgaataagagccacaatgactttgttgcaatcctggacctgccagaagga
gagcatcagtacaagttttttgtagatggccagtgggtccatgatgcctccgagcctgtt
gtaaccagtcaactcggcaccatcaacaatctgatccatgtaaaaaagtctgactttgag
gtgtttgatgccctgcatgttgactctctggagtgttctgactcatccgatttgtccagc
tctcctcctggtccttatggacaggaacagtacatcttcaggcctgaggaacgtttcaaa
gcccctccgattctccctcctcaccttcttcaagtcatactcaacaaagacaccaacata
tcttgtgaccctgctctgctgcctgagcccaaccacgtcatgctgaaccacttatatgct
ctctcaataaaggatggagtcatggtactgagtgcaacccaccgatacaagaagaaatac
gtcacctctctgctctacaaacccatttaa

KEGG   Cynoglossus semilaevis (tongue sole): 103396171
Entry
103396171         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: 5'-AMP-activated protein kinase subunit gamma-1-like
  KO
K07200  5'-AMP-activated protein kinase, regulatory gamma subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103396171
   04068 FoxO signaling pathway
    103396171
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103396171
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103396171
   04920 Adipocytokine signaling pathway
    103396171
SSDB
Motif
Pfam: CBS
Other DBs
NCBI-GeneID: 103396171
NCBI-ProteinID: XP_008332386
LinkDB
Position
20
AA seq 563 aa
MGSTVMESSKQGSKKMPKKRRSLRINMPDFGAFTSPQVERSVSSKSASQTGERLILTPSP
STAVKSPVSTPLPPCPQSAPVQSKMTSPKSIFPYPSPQSTSPKSSRRLSLGGIFRSPTSS
SPVSIKLFSRTRRASGLSTPPSTPAQVASQPAFPQEVQPSRPSPERLETSYRLRSLSTPP
DTGQXPSAKPPIPSSSPVPVYSTSQVYGLSEGMLEKLELDDDAAETESDIYTRFMKSHKC
YDIVPTSSKLVVFDTALQVKKAFFALVANGVRAAPLWDTEKQSFVGKNDRTFSRTLFVLY
RYYKSPMVQIYELEEHKLETWREVYLQATFKPLVNISPDASLFDAVYTLIKNKIHRLPVI
DPVTGNALYILTHKRILKFLQLFMREMPKPAFMKQTLSELGIGTYHDIAFIHPDTPIIKA
LNIFVERRVSALPVVDNSGKVVDIYSKFDVINLAAEKTYNNLDNTVTQALKHRSQYFEGV
VKCNKMETMETIVNRIVKAEVHRLVVVDEHASIEGIVSLSDILQALVLSPTEASKEENLT
MYEGGSVSNSGNLVGETAGKSTG
NT seq 1692 nt   +upstreamnt  +downstreamnt
atggggagcacggtgatggagtccagcaaacagggctccaagaaaatgccaaagaagcgg
agaagtctgcggattaacatgccagacttcggcgcatttacttccccacaagtggagagg
agcgtctcatccaagagtgcctctcagacgggggagcgcctgatcctgacaccaagcccc
agcacagcagtgaagagtccagtcagcacaccactgccaccatgtccacagtctgctccg
gtgcagtcaaagatgacctcacccaaaagcatctttccttacccctccccacagagcacc
tcacccaaatcctcccgcagactaagcctcggcgggatcttccgctcgccgaccagctcc
tcacctgtgagcatcaaactcttctcacgaaccaggagagcctctggtctctccacacca
cccagcacccccgcacaggtggccagccagcccgccttcccccaggaggtccagccgagc
aggccgagtcctgaacgcttggagacgagctacaggttgcgctcgctgtctacacctcca
gacacaggacagnncccttctgcgaaaccccccatcccttcatcaagccctgtgccagtt
tactctacctcacaagtctacggattatctgaaggcatgctggagaaacttgaacttgat
gatgatgctgctgaaactgagagcgatatttacacgcgctttatgaaatcccacaagtgc
tacgacattgtcccgacgagctctaagctggtggtgttcgacacagcgctccaagtcaag
aaagcgttcttcgccctggtagcaaatggtgtacgagctgcaccactatgggacacagag
aagcaaagctttgtgggtaagaatgacagaacattttccagaactttatttgttttatac
agatactacaagtcaccgatggtgcagatttatgaattggaggaacataagctggagaca
tggagagaggtctaccttcaagcaacattcaaacctctggttaacatatcacctgatgca
agcctttttgacgccgtctacaccctcatcaaaaacaaaattcaccgcctgcctgtcatt
gaccccgtcacagggaatgcactttatattctgactcacaagaggatcctcaagttcctt
cagcttttcatgcgtgaaatgccaaagccggccttcatgaagcagaccctctccgagctg
ggcatcggtacgtaccatgacatcgctttcatccacccagacacgcccatcatcaaagca
ctcaacatctttgtggagagaagagtgtctgctctgcctgtggtggataattctggaaag
gttgtggacatttactccaagtttgatgtaattaacttggctgctgagaagacatacaac
aacctggacaacacagtgacacaggctctgaagcatcgctcacagtactttgaaggcgtc
gtcaagtgcaacaaaatggaaaccatggagaccatcgtgaacagaatagtcaaagctgag
gtacaccggttagtggtggtggacgagcacgcaagcatcgagggcatcgtctccctgtcg
gacatcctccaggctctggtgctcagccccacagaagcctccaaggaggaaaacctgacc
atgtatgagggaggcagcgtaagcaatagtggaaacctggtgggagagactgcagggaag
tccactggctga

KEGG   Cynoglossus semilaevis (tongue sole): 103396932
Entry
103396932         CDS       T04866                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like isoform X1
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103396932
   04068 FoxO signaling pathway
    103396932
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103396932
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103396932
   04920 Adipocytokine signaling pathway
    103396932
SSDB
Motif
Pfam: AMPKBI DUF4758
Other DBs
NCBI-GeneID: 103396932
NCBI-ProteinID: XP_016898246
LinkDB
Position
W
AA seq 171 aa
MGNSSSDRTSGGQPGGKEARSNILIDSSEDADLFQREDSKAVMTSKTRTVNNVIQVRRTD
FEVFDALKVDSQDSADLSDLSSSPPGPYQQDGYVVKSEDKLKHPPILPPHLLQVLLNKDT
GISCDPTLLPEPNHIMLNHLYALSIKDGVIVLSATHRYKKKYVTTLLYKPI
NT seq 516 nt   +upstreamnt  +downstreamnt
atggggaacagcagcagtgacaggaccagcggggggcagcctggaggcaaagaagcccgc
tctaacatcctgatcgacagcagtgaggacgcagatctgttccagagggaggactcaaag
gccgtgatgacgtctaaaactaggaccgtcaacaacgtcatccaggtgaggagaacggac
tttgaagtgttcgatgccctcaaggtggactcgcaggactcggctgacctctcagacctg
tccagttctcctccgggcccctaccaacaggacgggtacgtggtcaaatcggaggacaaa
ctcaaacacccccccatcctgcccccgcacctgctgcaggtgctgctcaacaaggacacg
ggtatctcttgtgaccccacgctgctcccggagcccaaccacataatgttgaaccacctg
tacgccctgtccatcaaggatggcgtgatagttctcagcgcgacgcacagatacaagaag
aagtacgtgaccacgctgctgtacaaacccatctga

KEGG   Cynoglossus semilaevis (tongue sole): 103398104
Entry
103398104         CDS       T04866                                 

Definition
(RefSeq) 5'-AMP-activated protein kinase subunit beta-1-like
  KO
K07199  5'-AMP-activated protein kinase, regulatory beta subunit
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04371  Apelin signaling pathway
csem04530  Tight junction
csem04910  Insulin signaling pathway
csem04920  Adipocytokine signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04371 Apelin signaling pathway
    103398104
   04068 FoxO signaling pathway
    103398104
 09140 Cellular Processes
  09144 Cellular community - eukaryotes
   04530 Tight junction
    103398104
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103398104
   04920 Adipocytokine signaling pathway
    103398104
SSDB
Motif
Pfam: AMPK1_CBM AMPKBI CBM_48 CBM53 Sbi-IV
Other DBs
NCBI-GeneID: 103398104
NCBI-ProteinID: XP_008334838
UniProt: A0A3P8VPJ1
LinkDB
Position
Z
AA seq 259 aa
MGNSSSDRTSGGQPGGKEARSNILIDSSEDADLFQREDSKAPQEIQEFLAWQQDLESDSK
SPTQARPTVFRWTGGAKEVFVSGSFNNWATKIPLNRSRNNFVAIVDLPEGEHQYKFCVDG
QWTLDPTGAVMTSKTGTVNNVIQVRRTDFEVFDALKVDSQDSADLSDLSSSPPGPYQQDG
YVVKSEDKLKHPPILPPHLLQVLLNKDTGISCDPTLLPEPNHVMLNHLYALSIKDGVMVL
SATHRYKKKYVTTLLYKPI
NT seq 780 nt   +upstreamnt  +downstreamnt
atggggaacagcagcagtgacaggaccagtggggggcagcctggaggcaaagaagcccgc
tccaacatcctgatcgacagcagtgaggacgcagatctgttccagagggaggactcgaag
gctccgcaggagatccaggagttcctggcctggcagcaggacctggagagcgacagcaag
agtccaacgcaggctcgcccgaccgtcttcagatggacagggggcgctaaagaagtcttt
gtgtcaggctcttttaacaactgggccaccaaaatccccctcaacagaagccggaacaac
tttgttgccatagtggacctgccagagggggagcaccagtacaagttctgtgtggacggt
cagtggactctggatcccactggggccgtgatgacgtctaaaactggaactgtcaacaac
gtcatccaggtgaggagaacggactttgaagtgttcgatgccctcaaagtggactcgcag
gactcagctgacctctcagacctgtccagctctcctccgggcccctaccaacaggacggg
tacgtggtcaaatcggaggacaaactcaaacacccccccatcctgcccccgcacctgctg
caggtgctgctcaacaaggacacgggtatctcttgtgaccccacgctgctcccggagccc
aaccacgtcatgttgaaccacctgtacgccctgtctatcaaggacggcgtgatggttctc
agcgcgacgcaccgatacaagaagaagtacgtgaccacgctgctgtacaaacccatctga

DBGET integrated database retrieval system