KEGG   Cynoglossus semilaevis (tongue sole): 103376707
Entry
103376707         CDS       T04866                                 

Gene name
pdgfra
Definition
(RefSeq) platelet-derived growth factor receptor alpha isoform X2
  KO
K04363  platelet-derived growth factor receptor alpha [EC:2.7.10.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04020  Calcium signaling pathway
csem04144  Endocytosis
csem04510  Focal adhesion
csem04540  Gap junction
csem04810  Regulation of actin cytoskeleton
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103376707 (pdgfra)
   04020 Calcium signaling pathway
    103376707 (pdgfra)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103376707 (pdgfra)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103376707 (pdgfra)
   04540 Gap junction
    103376707 (pdgfra)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103376707 (pdgfra)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01001 Protein kinases [BR:csem01001]
    103376707 (pdgfra)
  09183 Protein families: signaling and cellular processes
   04090 CD molecules [BR:csem04090]
    103376707 (pdgfra)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.10  Protein-tyrosine kinases
    2.7.10.1  receptor protein-tyrosine kinase
     103376707 (pdgfra)
Protein kinases [BR:csem01001]
 Receptor tyrosine kinases (RTK)
  PDGFR family [OT]
   103376707 (pdgfra)
CD molecules [BR:csem04090]
 Proteins
  103376707 (pdgfra)
SSDB
Motif
Pfam: PK_Tyr_Ser-Thr I-set Pkinase Ig_3 ig Ig_2 V-set Ig_5 Herpes_gE C2-set_2 Kinase-like
Other DBs
NCBI-GeneID: 103376707
NCBI-ProteinID: XP_008305410
LinkDB
Position
2
AA seq 1474 aa
MDGVKMFVIFGGIMMLLVSVSCELSPPTIEATEEEFILKLNSMFNISCSGKSKRRVVWAE
PLPENTFVYPGYYTATLFIDNATVENTGYYMCVYETQEGQLESEPEEDNEAGIYVFVPDP
TAPFVPETPENLVVPMDLSGVPISCRVSDPYLDVILRSVPSEEEMHAYYDSRMGFFGTLS
PGQYQCETSVNNQVARSAIYTVNAEAPEEMEDFSVEVKASDENVRVGQPFFIICMAPTGP
TFQQQWLHPKKQAMYTDQVKQTLPDHVVYTLSVSQASSQDSGVYECSVTNTVNGEVRVNS
VAINVFEENSFVSLHHSGIFEVEYVSLLQETEFTVFIDASPPPKVMWLKDGKELPANYFI
DTQTVPFQGNRYQSTLTLRQPLEKDNGNYTVVAHSGSHTAQFSFNIKVKASTSAFFPPSS
APVLLPQTDELIVTLHTPFTLSCRGEAKLAWDTPQDVREQTQEDNSGLFVSSIIVDSATA
IHTGHYICFYNSNTTEEIGETSIYIYVPDPDVPFVPSLVPFSKHILSDHEEMEIQCRVSD
PSANVTLINVDTQQPVPSVYDSKRGALGIFTVGTYMCKALINGEEHYSEEYIVHGWTGGA
GLHVELTAKRTALLVGEAITITCLARGSEILEDHWKYPGKLASRGVKTVRENKRNHEILY
TLTIAQATTKDSGIYSCSITDVISNESQTKELVIRVFAGEFMSIKPLFKEYESAQLDEVR
EFRAEITSFPTAHVTWLKGGIPLSNVTAEISTSLRQLSETSYLSTLTLIRAKEEDSGNYT
MRVENGNQSQDTGLTLEVKVPAVIMELVDIHHGSATGQSVVCISRGQPTPVVEWFICKNI
KQCANDSSLWVPLTINSTKITVDSHVDQDNNLESQVMFGHLENTVAVRCLARNEMAAVSR
EIKLVSNGPQPELTVAAAVLVLLVIVIISLIVLVVIWKQKPRYEIRWRVIESVSPDGHEY
IYVDPMQLPYDSRWEFPRDRLVLGRILGSGAFGKVVEGTAYGLSRSQPVMKVAVKMLKPT
ARSSEKQALMSELKIMTHLGPHLNIVNLLGACTKSGPIYIITEYCFYGDLVNYLHKNREN
FLSLNPEKNKKELDIFGINPADESSRSYVILSFEQTKGDYMDMKQADNTQYVPMLEMSNA
SKYSDIQTSDYDHPPSQKGSNEGEMDILLSEDMNEGLTTTDLLSFTYQVARGMEFLASKN
CVHRDLAARNVLLSQGKIVKICDFGLARDIMHDNNYVSKGSTFLPVKWMAPESIFDNLYT
TLSDVWSYGILLWEIFSLGGTPYPGMVVDSSFYNKIKSGYRMSKPEHAPHDVYEMMMKCW
NSEPEKRPSFLGLSETVATLLPSSYKKHYERINCEFLKSDHPAVTRVCVENDDAYIGISY
KNQGKLKDRESGFDEQRLSSDSGYIIPLPDLDPISDDEYGKRNRHSSQTSEESAIETGSS
SSTFAKREGETLEDITLLDEMCLDCSDLAEDSFL
NT seq 4425 nt   +upstreamnt  +downstreamnt
atggatggggtgaagatgtttgtcatctttgggggcataatgatgctgctggtttcagtt
tcttgcgaactgtcaccaccaacaattgaggccactgaggaggaattcatcctgaagctc
aactctatgttcaacataagctgctcagggaaaagtaaaagaagggtggtttgggctgaa
cctctaccagaaaacacttttgtttatccaggatactacacagcaacactcttcatcgac
aatgccacagtagaaaacactggctactacatgtgtgtgtatgaaacacaagagggacaa
ctggagagtgagccggaagaggacaacgaggcaggaatatacgtctttgtcccagatccc
acagccccatttgttcccgagacccctgagaacttggtggtccccatggacctatctggt
gtccccatctcctgccgtgtctctgacccttaccttgatgtcatcctgaggagcgtcccc
agtgaggaggagatgcacgcttactacgacagcaggatgggctttttcgggaccctttca
cctggacagtaccagtgtgagaccagtgtaaacaaccaggttgccagaagtgccatttat
acggtgaatgccgaagctccagaagagatggaggattttagtgtggaagtaaaagccagc
gacgaaaatgtgagagtcgggcaaccgttcttcatcatctgcatggctcccactgggcca
acctttcagcagcagtggctccatcctaaaaaacaggctatgtatacggaccaggtaaaa
cagactctccccgaccacgtcgtctatactctcagcgtctcgcaggcctcttctcaggac
agtggcgtctacgagtgctcggttactaacacagtaaatggcgaggtcagagtcaacagt
gtcgccatcaatgtctttgaggagaattcctttgtgtcactgcaccacagtgggattttt
gaagtggagtatgtcagccttctacaggagactgaattcactgttttcatcgatgcctcc
cctcctcccaaggtgatgtggctgaaggatggcaaagaactaccagccaactacttcatc
gacacccagactgttccatttcaggggaatcgatatcaaagcaccctaacgttacggcag
cctcttgagaaagacaatgggaattacactgttgtagcccacagtggctcccacaccgct
cagttctcatttaatatcaaagtcaaagcctccacttcagccttcttcccaccatcctct
gctccggtgctgctgccacagaccgatgagttgatcgtgaccctacacactcccttcacc
ctaagctgcagaggagaggccaaactggcttgggacacgccacaagatgtgcgtgaacaa
acacaggaggacaacagtggcctgtttgtctcgtccatcattgtggacagtgctactgca
atacacactggccactacatctgcttttacaacagcaacaccacggaggagattggagaa
accagcatctacatttatgtaccagatccagatgttccctttgtgccatcactggtgcct
ttcagcaaacacatcctgtctgaccatgaggaaatggagatccagtgtcgtgtgtctgat
cccagtgccaacgtgacgctcatcaatgttgacacgcagcagcccgtgcctagcgtttac
gacagtaagagaggagctctgggcatattcactgtgggcacctacatgtgtaaagccctc
ataaatggagaagaacactacagtgaggaatacattgtccacggctggacaggtggtgct
gggctgcacgttgagctgacagccaagaggaccgctctgctggtgggagaagccatcacc
atcacctgtctggctcgtggttctgaaatcctggaagaccactggaaataccccggcaaa
ctggccagtcgtggagtcaaaactgtccgtgagaacaaaaggaaccacgagattctctac
actttgacaattgcacaggctacaaccaaagacagcggcatctactcatgttccatcact
gatgtcatcagtaacgagagccagacaaaggaactggttattagagtttttgcaggtgaa
tttatgtccatcaagccgctgtttaaagaatatgaatcagcacagctggatgaggtgcgg
gagttcagagcagaaatcacttccttcccaactgctcatgtcacatggctgaaaggtggg
atccctctcagcaacgtgacggcggagatctccaccagcctgcggcagctcagtgagacc
agctacttgagtaccctcaccctgatccgggccaaagaagaggacagtgggaattatacg
atgagagtggagaacggaaaccagagtcaggacactggcctaaccctggaggtcaaagta
ccagcggtcatcatggagctggtggacatccaccacggttcagccacaggccagtctgtg
gtgtgtatttctagggggcagcccacccctgtggtggagtggttcatctgcaagaacatc
aaacaatgtgccaatgactcgtccctgtgggtgcccctcactatcaattcaacaaaaatc
acagtggactcccatgttgaccaggacaacaacctggagagccaggtcatgtttggtcat
ctggagaacaccgtggcggtgcgctgcctggccaggaacgaaatggccgctgtcagcagg
gagatcaaactggtctcaaatggccctcaaccagagctgactgtagctgctgctgtgctg
gtgctactggttattgtcatcatctcactcattgtcttggttgttatctggaaacagaaa
ccaagatacgaaatccgctggagggtcatcgagtcggtcagcccagatggtcatgagtac
atctatgtggatccaatgcaacttccttatgattccagatgggaatttccccgtgacaga
cttgtgctcggtcgtatcctgggctctggagcctttgggaaggtggtagagggcacggcc
tacggactcagccgctcccagcctgtcatgaaggtggcggtcaaaatgttaaaacctaca
gcacgctccagtgagaaacaagctctgatgtcggagctgaagattatgactcatctcggc
cctcacctgaatatcgttaaccttctgggagcttgcacgaaatcaggccctatctacatc
atcacagagtactgcttctacggggacttggtcaactacctgcacaaaaacagggagaac
ttcctgagcctgaacccagagaagaacaaaaaagaactggacatctttggaatcaaccct
gccgacgagagcagcaggagttatgtgatcctgtcgttcgagcaaaccaaaggagattac
atggacatgaaacaagctgacaacacccagtatgtgcccatgctggagatgagcaacgct
tcaaaatactctgacatccagacatcggactacgaccacccaccctcccagaaaggctca
aatgaaggtgaaatggacatcctgctgtcagaggacatgaacgagggcctcaccaccacg
gacctgctcagcttcacctaccaagtggccagaggcatggagttcttagcctccaagaac
tgtgtgcaccgggacctcgcagccaggaatgtacttctctctcagggcaaaatagtcaag
atctgtgactttggactggccagagacatcatgcatgacaacaactatgtctccaaagga
agcaccttcctgccagtgaagtggatggcccccgagagtatctttgacaatctctacaca
actctgagtgatgtctggtcttatggcatcctcctctgggagatcttctctctgggtgga
accccgtacccaggaatggtggtggattccagcttctacaacaagatcaagagtggctac
cggatgtccaagcctgaacatgctcctcatgacgtgtatgaaatgatgatgaagtgctgg
aacagcgagccagagaagaggccatcttttctgggtttgagtgaaactgttgcaaccttg
cttccctccagctacaaaaagcattatgagaggattaactgcgagttcctgaagagcgac
caccctgctgtaactcgtgtgtgtgtggagaacgacgacgcctacataggcatttcctac
aagaaccagggcaagctaaaggaccgggaaagtgggtttgatgagcagcgtctgagctct
gacagcggctacatcattcctctgcccgacctggaccccatatctgatgatgaatatgga
aaaagaaacagacacagctctcagacatcggaggagagtgccatcgagactggttccagc
agctcaaccttcgctaagcgtgaaggggagaccttggaggacattacactgctggatgag
atgtgtctggactgtagtgatctggcagaggacagctttctgtga

DBGET integrated database retrieval system