KEGG   Cynoglossus semilaevis (tongue sole): 103376719
Entry
103376719         CDS       T04866                                 

Gene name
jun
Definition
(RefSeq) transcription factor AP-1
  KO
K04448  transcription factor AP-1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04137  Mitophagy - animal
csem04210  Apoptosis
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103376719 (jun)
   04012 ErbB signaling pathway
    103376719 (jun)
   04310 Wnt signaling pathway
    103376719 (jun)
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103376719 (jun)
  09143 Cell growth and death
   04210 Apoptosis
    103376719 (jun)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103376719 (jun)
   04530 Tight junction
    103376719 (jun)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103376719 (jun)
   04621 NOD-like receptor signaling pathway
    103376719 (jun)
   04625 C-type lectin receptor signaling pathway
    103376719 (jun)
  09152 Endocrine system
   04912 GnRH signaling pathway
    103376719 (jun)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103376719 (jun)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103376719 (jun)
Transcription factors [BR:csem03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    103376719 (jun)
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 ZapB PspA_IM30 FlaC_arch DUF3450 Jnk-SapK_ap_N Fib_alpha TEX13 Synaptobrevin
Other DBs
NCBI-GeneID: 103376719
NCBI-ProteinID: XP_016896323
LinkDB
Position
2
AA seq 326 aa
MYAKMETTFYEDSLNAFSQHENTGYGYSDAKALKHNMTLNLSDPSGTLKPHLRAKASDIL
TSPDVGLLKLASPELERLIIQSSNGLITTTPTPTQFVCPRNVTDEQEGFAEGFVRALAEL
HHQHMPAQPNVSVTSAPQTTVNSALPPISSVAGATVYNNNGALRSDSPVYEDLNAFNTAN
TTASAQNYTTSAPTMSFTAAPQLPIYGQPSSAQHPRLTTLKEEPQTVPEMPGETPPLSPI
DMESQERIKAERKRMRNRIAASKCRKRKLERISRLEDKVKNLKSQNSELASTANMLREQV
AQLKQKVMNHVNSGCQLMLTQQLQTF
NT seq 981 nt   +upstreamnt  +downstreamnt
atgtatgccaagatggaaactactttctatgaagactcactcaacgctttctcccagcac
gaaaacaccggctacggatacagcgacgccaaagctctgaaacacaacatgacgctgaac
ctgtccgatccgtccggaactttgaaacctcatctgcgggccaaggcgagcgacatcctt
acatcccccgacgtgggcttactgaagttggcttctcctgagctggagcggcttatcatc
cagtccagcaacggactcatcaccacaacgccgacaccgacccagttcgtgtgtcctaga
aacgtcacggatgagcaggagggcttcgctgaggggtttgtgcgagctctggccgagctc
caccaccagcacatgccggcccagcctaatgtcagtgtcacctccgccccgcagaccact
gtcaacagtgcgttgccgcctatctcctctgtcgcgggagccactgtttacaacaacaac
ggcgctctgcgttccgattcacctgtttatgaggatcttaacgccttcaacacagcaaac
accacagcctcggctcaaaattacaccacctcagccccaactatgtccttcaccgctgcg
ccacaactacccatctacggtcagccctcctctgcccagcatccgcggctcaccacgctc
aaagaggagccccaaactgtgcccgaaatgccgggggagaccccaccactctccccgatt
gacatggaaagccaagagcgcatcaaggcggagagaaagaggatgcgtaaccgtatcgcc
gcgtctaagtgccgcaaaaggaagctggagagaatttcgaggctggaggataaagtgaag
aacctcaagtcccagaactcggaacttgcgtccaccgccaacatgctacgtgagcaggtg
gcacaacttaagcagaaagtgatgaaccacgtcaacagcggttgccagctcatgttgacc
cagcagctccagactttctga

KEGG   Cynoglossus semilaevis (tongue sole): 103398819
Entry
103398819         CDS       T04866                                 

Definition
(RefSeq) transcription factor AP-1-like isoform X2
  KO
K04448  transcription factor AP-1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04137  Mitophagy - animal
csem04210  Apoptosis
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
csem04620  Toll-like receptor signaling pathway
csem04621  NOD-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04912  GnRH signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103398819
   04012 ErbB signaling pathway
    103398819
   04310 Wnt signaling pathway
    103398819
 09140 Cellular Processes
  09141 Transport and catabolism
   04137 Mitophagy - animal
    103398819
  09143 Cell growth and death
   04210 Apoptosis
    103398819
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103398819
   04530 Tight junction
    103398819
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103398819
   04621 NOD-like receptor signaling pathway
    103398819
   04625 C-type lectin receptor signaling pathway
    103398819
  09152 Endocrine system
   04912 GnRH signaling pathway
    103398819
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103398819
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103398819
Transcription factors [BR:csem03000]
 Eukaryotic type
  Basic leucine zipper (bZIP)
   AP-1(-like) components, Jun
    103398819
SSDB
Motif
Pfam: Jun bZIP_1 bZIP_Maf bZIP_2 NBP1 VIR_N Phlebovirus_NSM Jnk-SapK_ap_N ZapB
Other DBs
NCBI-GeneID: 103398819
NCBI-ProteinID: XP_008335783
LinkDB
Position
Unknown
AA seq 319 aa
MSRKMEATFYDEAVKASNSQHEGAAMFGFNPKILKQTMTLNLNDPKNFKPHLGAKALDIL
TSPDVGLLKLASPELERLIIQSCTSLTTPTPTQFLGPKNTTDEQEGFAEGFVRALAELHY
QQQMPVGHPGGAQAGGVVSGTSGSEGGGMSYSCTARAEPPEYTNLGAGYRAVGSASAPGA
EKQPPPPPPPPPATTGYPSHMDHQQQHPRLHALKEEPQTVPEMSGDTPPLSPIDMESQER
IKAERKRMRNRVAASKCRKRKLERISRLEDRVKNLKSQNTELVSSANVLRDELALLKQKV
MDHVNSGCQLILTQQLQGY
NT seq 960 nt   +upstreamnt  +downstreamnt
atgtctaggaaaatggaagcgaccttttacgacgaagccgtcaaagcttccaactcgcag
cacgaaggagcggctatgtttggcttcaaccccaaaattctgaaacaaaccatgactttg
aaccttaacgaccctaaaaacttcaaacctcacctgggtgctaaagccctagacatcctg
acgtctcccgatgtgggtttactgaagctggcctcgcctgaactggagagactgataatc
cagtcctgcaccagcctcacgactccgacaccaacccagttcctgggcccaaaaaacact
accgacgaacaggagggtttcgccgagggctttgtgagggctctggctgagctccactac
cagcagcagatgccggtcgggcatcccggcggcgcgcaggccggcggtgttgtgtcaggc
accagtgggtccgagggcggcgggatgtcttacagctgcacggcgcgcgccgagccgcct
gagtacaccaacctgggcgctgggtaccgggctgtgggttctgcgtcagcacctggcgcc
gagaagcaaccgccgccgccaccaccaccaccaccagcaaccacgggatacccgtcccac
atggaccaccagcaacagcacccgcggctacacgcgctcaaagaggaacctcagaccgtg
ccggagatgtccggggataccccgcctctgtcccccatagacatggaatcccaagagcgc
attaaggccgaaaggaagcgtatgagaaacagggtagccgcgtccaagtgccggaaaagg
aagctggagaggatctcccggctggaggacagggtcaaaaacctcaagagccaaaacacg
gagttggtttcctccgctaacgtcctgagagacgagctggccctgctgaagcagaaggtc
atggaccacgttaacagcggctgccagctcattttgacgcagcagctacagggttactaa

DBGET integrated database retrieval system