KEGG   Cynoglossus semilaevis (tongue sole): 103376789
Entry
103376789         CDS       T04866                                 

Definition
(RefSeq) transforming growth factor beta-3
  KO
K13377  transforming growth factor beta-3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103376789
   04350 TGF-beta signaling pathway
    103376789
   04068 FoxO signaling pathway
    103376789
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103376789
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103376789
   04218 Cellular senescence
    103376789
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103376789
Cytokines and growth factors [BR:csem04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103376789
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103376789
NCBI-ProteinID: XP_008305524
UniProt: A0A3P8UCA4
LinkDB
Position
1
AA seq 403 aa
MNLGKALLFFLLSNFVTMTLSLSTCTTVDIDHIKKKRVEAVRGQILSKLRLTSPPQTTGP
SQVPYQVLALYNSTKELIEELGRDRQQSCGQDNTETEYYAKEIYKFNMINGPPENNDLSY
CPKSVTSKVFRFNVSIMEKNSTNLFRAEFRALRIPNPVAKGNEQRIELYQILQKDDPKAK
QRYIGGKNVLTKGTPEWVSFDVTQTVREWLMYRQTNLGLEISVHCPCHTFRPNGDIIENT
NEVLEVKFKGMEPEYEERKFKPKEQLYPHLILMMLPPHRLDAQSSSRRRKRALDTNYCFN
NYEENCCVRPLYINFRQDLGWKWIHQPEGYYANFCSGPCPYLRSADTTHSSLLSLYNTLN
PEASASPCCVPQDLEPLTILYYVGRSPKVEQLSNMVVKSCKCS
NT seq 1212 nt   +upstreamnt  +downstreamnt
atgaatctgggaaaagcgctcctgtttttcctcctgtccaactttgtgacgatgactctg
tcgctgtccacctgcaccaccgtggacattgaccacataaagaaaaagagagtggaggcg
gtgaggggacagattcttagtaaactgcgactgaccagtccgccgcagaccacaggtcca
agtcaggtaccgtaccaggttctggccctttataacagtaccaaggagctgatcgaggag
ctgggcagagacagacagcagagctgtgggcaggataacacggagaccgagtactacgcc
aaagagatttacaagttcaacatgatcaatggtccgccagaaaacaatgacctttcctac
tgccccaagagtgtcacctccaaggtgttccgcttcaacgtgtccatcatggagaagaac
tccaccaacttgttccgggcagagtttcgagctctgcggatccccaaccccgttgccaag
ggaaacgagcagaggatcgagctctaccagatcctccagaaagacgatcccaaagccaaa
cagcgctacatcggaggcaagaatgtcctgaccaagggaacgcctgagtgggtctccttt
gatgtcacccagacagtgagggagtggctaatgtacagacagaccaaccttggcctggag
atcagtgtgcactgcccctgccataccttcaggcctaatggagacattattgagaacacc
aacgaggtgctggaggtcaagttcaaaggtatggaaccagaatacgaggaaagaaagttc
aaaccaaaggagcagctctaccctcacctcatcctcatgatgctgccaccccacaggctg
gacgcccagtcctcgtcccgtaggcgcaagagggcacttgacaccaattactgcttcaac
aattacgaggagaactgctgcgtgcgaccactatatattaacttccgtcaagatctggga
tggaagtggatccatcagcctgaaggctactatgccaacttctgttccggtccgtgtcct
tatctacgcagcgctgacaccacccacagctcgctgctgagcctctacaacaccctgaac
ccggaagcctccgcctcgccctgctgtgttcctcaggacttggagcccctgaccatcctg
tactacgtgggtcgctccccaaaagtcgagcagctctcaaacatggttgtcaagtcctgc
aagtgcagctag

KEGG   Cynoglossus semilaevis (tongue sole): 103377845
Entry
103377845         CDS       T04866                                 

Definition
(RefSeq) transforming growth factor beta-1
  KO
K13375  transforming growth factor beta-1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04350  TGF-beta signaling pathway
csem04672  Intestinal immune network for IgA production
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103377845
   04350 TGF-beta signaling pathway
    103377845
   04068 FoxO signaling pathway
    103377845
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103377845
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103377845
   04218 Cellular senescence
    103377845
 09150 Organismal Systems
  09151 Immune system
   04672 Intestinal immune network for IgA production
    103377845
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:csem03110]
    103377845
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103377845
   00536 Glycosaminoglycan binding proteins [BR:csem00536]
    103377845
Chaperones and folding catalysts [BR:csem03110]
 Intramolecular chaperones
  Others
   103377845
Cytokines and growth factors [BR:csem04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103377845
Glycosaminoglycan binding proteins [BR:csem00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103377845
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103377845
NCBI-ProteinID: XP_008307032
UniProt: A0A3P8V3J3
LinkDB
Position
4
AA seq 386 aa
MKLALLMLTVVYMVGSVSSMSTCKTVDLEMVKKKRIEAIRSQILSKLRLPKEPEEDQAGD
QEAIPLTLLSLYNSTKEMLKEQQTGAQTVISTEQEEEEYFAKVLHKFNMTNTGTDMKDKK
SIEFLFNLSNIRQSVGDYHLLTRAELRLLIKTPNIATKQRVELYTGLGSSPEYLTTRFIT
TNLKDKWLSFDVTETLQNWLKGNETEQGFQLWVFCGCNNDPSMENTFKFSISGVSFGRGD
TQTLEALTKQPPYILTMSIPQNVSSHITSRKKRATDGKADTCTTQTETCCVRSLYINFRK
DLGWKWIHEPTGYHANYCMGSCTYIWNAENKYSQILALYKHHNPGASAQPCCVPQALEPL
AIIYYVGRQHKVEQLSNMSVTSCKCS
NT seq 1161 nt   +upstreamnt  +downstreamnt
atgaagctcgcgctgttgatgcttacggtggtgtacatggtgggcagtgtgagcagcatg
tccacatgtaagactgtagacctggagatggtgaagaagaagcggatcgaagccatcagg
agccagatcctcagcaagctgcgtcttcccaaggagccggaggaggatcaggctggagac
caggaggcgatccctttgactctgctctccctctacaacagcaccaaggagatgttgaag
gagcagcagacgggggcccagacggtcatctccacagagcaggaggaggaggagtacttc
gccaaggtcctgcacaagttcaacatgaccaatacaggtacagacatgaaggacaagaaa
agcatcgaattcctcttcaacctctctaatataaggcaaagtgttggggattaccacctg
ctgaccagagccgagctgcggttgcttatcaagacaccgaacatagcgacaaagcagcgg
gttgagctctacacgggcctgggatcctcacccgagtacctcactactcgcttcatcact
actaatctgaaggacaagtggctatcttttgatgtgactgagaccctgcagaactggctc
aaagggaatgagaccgagcagggtttccagctctgggtcttctgtggttgcaacaacgac
ccaagtatggaaaacacgttcaagttttctatctctggggtctcttttgggaggggagac
acacagacgcttgaggcgttgacgaaacaaccaccatatatcctgaccatgtccattcct
caaaacgtcagcagccacatcacctcccgcaaaaaacgggccacagatgggaaagcagat
acatgtactacccagacggagacctgctgtgtgcgaagcttgtacatcaatttccggaaa
gacctgggctggaagtggatacacgaaccgacgggctaccacgccaactactgcatgggc
tcctgcacctacatctggaacgcagaaaacaaatattctcagattttggctctgtataag
catcacaacccaggagcctctgcccagccctgctgtgttccccaggcactggaaccactg
gcaatcatatactatgtcggcaggcagcacaaggtggagcaactgtccaatatgagcgta
acgtcctgcaagtgtagctaa

KEGG   Cynoglossus semilaevis (tongue sole): 103380810
Entry
103380810         CDS       T04866                                 

Definition
(RefSeq) transforming growth factor beta-3-like
  KO
K13377  transforming growth factor beta-3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103380810
   04350 TGF-beta signaling pathway
    103380810
   04068 FoxO signaling pathway
    103380810
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103380810
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103380810
   04218 Cellular senescence
    103380810
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103380810
Cytokines and growth factors [BR:csem04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103380810
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103380810
NCBI-ProteinID: XP_008311127
UniProt: A0A3P8WZ10
LinkDB
Position
7
AA seq 409 aa
MHLGKAVLFVLLLNCATLSSCLSTCATVDIDHVKRKRVEAIRGQILSKLRLTSPPHSLGP
SKIPYQIQALYNSTKELLEQLGRDRQQSCGQDNTETEYYAKEIYKFDMVTPESNDVHYCV
KGSTSKVFRFNVSAMERNSTNLFRAEFRALRMPNQSAKKNEQRIELYQILRPNEHITKQR
YIAAKNVLTRGTPEWVSFDVTETVREWLYNRGSNLGLEISVHCPCHTFNPNGDIIDDEKE
VLEVKFKGVDGEEEPSRWDQEQKKDPKNQKQQVLPHLILMMIPPHRLETQHTRRRKRGLD
SNYCFSSTEQSCCVRKLHIDFRRDLDWKWIHEPSGYEANYCSGPCPYLRSADSTHSSLLG
LYNTLNPDASAAPCCVPQDLEPLTILYYSGRTPKVEQLSNMIVKSCKCS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgcatttgggtaaagctgtgctgttcgtcctcctcctcaactgcgcaacgttgagctcc
tgcctgtcaacctgcgccaccgtggacattgaccacgtgaagaggaagagggtggaggcg
ataagaggtcagattctgagcaaactgagactgaccagtcctccacactcactgggaccc
agtaagatcccctaccagatccaggcgctgtacaacagcaccaaggagctcctggagcag
ctcggcagggaccggcagcagagctgcggtcaggacaacacagagacagagtactatgcc
aaagagatttataaattcgacatggtgacgccggagagtaacgatgtgcactattgtgta
aaaggcagcacctcaaaggtttttcgcttcaacgtctctgccatggaaaggaactcgacc
aacctcttcagggcagagttccgtgctctgaggatgccaaaccagagtgccaagaagaac
gaacagaggattgagctctaccagatcctgaggccaaacgaacacatcacaaaacagcgc
tacattgcagctaagaatgtgctgaccagaggaactccagaatgggtgtccttcgatgtg
actgaaactgtgagggaatggctgtacaacagaggaagtaatctggggctggagatcagt
gttcactgcccctgccacaccttcaaccctaatggtgacatcatcgacgatgagaaggag
gtgctggaggtgaaattcaaaggtgtggatggagaggaggagccgagtcgttgggatcag
gagcagaagaaggacccaaagaatcaaaaacaacaggtcctgcctcacctcatcctcatg
atgatcccaccacaccgtttagagactcagcacacacgccgacgcaagagaggcctggac
tcaaactactgtttctcaagcactgagcaaagctgctgtgttcgtaaacttcacattgat
ttccgtcgtgacctggactggaagtggatccatgagcccagtggttatgaggccaactac
tgctctgggccctgcccttatctgaggagcgcagactccacacacagctcattgttgggt
ctgtacaacaccctgaacccagacgcgtcggccgccccctgctgtgttcctcaagaccta
gaacctctgacgatactctactactctggacggaccccgaaagtggagcagctctcaaac
atgatcgtcaagtcctgcaagtgtagctga

KEGG   Cynoglossus semilaevis (tongue sole): 103388748
Entry
103388748         CDS       T04866                                 

Gene name
tgfb2
Definition
(RefSeq) transforming growth factor beta-2
  KO
K13376  transforming growth factor beta-2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103388748 (tgfb2)
   04350 TGF-beta signaling pathway
    103388748 (tgfb2)
   04068 FoxO signaling pathway
    103388748 (tgfb2)
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103388748 (tgfb2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103388748 (tgfb2)
   04218 Cellular senescence
    103388748 (tgfb2)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103388748 (tgfb2)
   00536 Glycosaminoglycan binding proteins [BR:csem00536]
    103388748 (tgfb2)
Cytokines and growth factors [BR:csem04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103388748 (tgfb2)
Glycosaminoglycan binding proteins [BR:csem00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103388748 (tgfb2)
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta SPEG_u2
Other DBs
NCBI-GeneID: 103388748
NCBI-ProteinID: XP_008322101
UniProt: A0A3P8VQE7
LinkDB
Position
13
AA seq 409 aa
MNLCVVSLLLTLDLATVAFSLSTCSTLDMDQFKKKRIRAIRGQILSKLKLTSPPEEYPEP
EEVSRDIVAIYNSTRDLLLEKANERAATCERQRSEEEYYAKEVYKIDMQPFYPSENVISP
THLNPYFRRLTFDVSSMEKNASNLVKAELRIFRLQNPAARVSEQRIELYQILGHKDLTSP
TQRYIDSKVVRTQTEGEWLSFDVTEAVSEWLNHRDRNSGFKISLHCPCCTFVPSNNYIIP
NKSEELEARFAGIDDSFIHGGDKRRRHSARAPHLLLMLLPTYRLESQSQHKSHRSKRALD
AAYCSKNVQDNCCLRSLYIDFKKDLGWRWIYEPKGYEANFCAGACPYLWSADTQHTKVLG
LYNSINPEASASPCCVSQDLEPLTILYYIGKTPKIEQLSNMKVKSCKCS
NT seq 1230 nt   +upstreamnt  +downstreamnt
atgaacctgtgtgtagtcagtcttctcctcactttggatctagccaccgtggcgttcagt
ctgtccacatgcagtacgctggacatggatcagttcaagaagaagcgcatccgggccatc
cggggccagatcctgagcaagctgaagctcaccagtccgccagaggagtacccagagccg
gaggaggtgtcccgggacattgtggccatatacaacagcaccagagacctgctgctggag
aaagccaacgaacgggcagcgacgtgtgagcggcagcgcagcgaggaggagtactacgcc
aaggaggtgtacaagattgacatgcagcccttttacccatcagagaatgtcatctctcct
acacacctcaacccctacttcaggcggctgacattcgatgtctcctccatggagaagaac
gcgtccaacctggtgaaggctgagctcagaatctttcgtcttcagaaccctgctgctcga
gtttctgagcagcgcattgagctctaccagatattaggacacaaagacttgacatcgcca
acgcagcgatacatcgacagcaaagtggtgcgaacgcagacagagggagagtggctgtcc
tttgacgtcacagaggcagtgagtgagtggctgaaccacagagacagaaacagtggattt
aaaatcagcctgcattgtccctgctgcacgttcgtaccatcaaataattatattattccc
aacaagagcgaggagctggaggcacgtttcgcaggcattgatgacagcttcattcatggt
ggtgataagaggcggcgacacagcgctcgggctccgcacctcctcctcatgcttctgcct
acataccgtctggagtctcagtcccagcacaagagccatcgatccaagagagccctggat
gctgcctactgctccaaaaatgtgcaggacaactgctgcttacgctcactctacatcgat
tttaaaaaggacttgggctggaggtggatctatgaaccaaagggatatgaggccaacttc
tgtgccggggcgtgtccttatctgtggagtgccgacacccagcatactaaggtgttaggc
ctctacaattccataaaccctgaagcctctgcctcaccctgctgtgtctcccaggacctg
gagcccctcaccatcctctactacatcggcaaaacccctaaaatagagcagctctccaac
atgaaggtcaagtcctgcaagtgcagctag

KEGG   Cynoglossus semilaevis (tongue sole): 103390834
Entry
103390834         CDS       T04866                                 

Definition
(RefSeq) transforming growth factor beta-2-like
  KO
K13376  transforming growth factor beta-2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04060  Cytokine-cytokine receptor interaction
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04350  TGF-beta signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103390834
   04350 TGF-beta signaling pathway
    103390834
   04068 FoxO signaling pathway
    103390834
  09133 Signaling molecules and interaction
   04060 Cytokine-cytokine receptor interaction
    103390834
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103390834
   04218 Cellular senescence
    103390834
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103390834
   00536 Glycosaminoglycan binding proteins [BR:csem00536]
    103390834
Cytokines and growth factors [BR:csem04052]
 Cytokines
  Transforming growth factors (RSTK binding)
   103390834
Glycosaminoglycan binding proteins [BR:csem00536]
 Heparan sulfate / Heparin
  Growth factors/receptors
   103390834
SSDB
Motif
Pfam: TGFb_propeptide TGF_beta
Other DBs
NCBI-GeneID: 103390834
NCBI-ProteinID: XP_008325099
UniProt: A0A3P8V4C6
LinkDB
Position
15
AA seq 421 aa
MWLPRLALLLLLRFSSLPSPGAEGLNTCQSINLDAQKSRRIEAVRGQILSKLRIRSPPKD
DEAPVPGPVPPEVMLLYNSTRELLKERARQAESACERESSEEDYYAKEVQRIDMLPTRTT
TNAVQPVAPSPHYRVVQFDVSGVDLTNSTLVMAEFRIFRAPNPQARASEQRVEIYQLLKP
DEESTSTQRYIDSRTVQPKAKGSWMSVDVTETVKDWLSDPENNLGLKLGVHCPCCTFVPS
TNNIVPNKSEELEALFAGVDDEKIRQIRKPGQVKGQPDVSTKTPHLILTLLPSDRVDNPA
KKNRKKRAAATDASTCSRGSDQGCCLRSLYIDFRRDLNWKWIHEPKGYKANFCAGNCPYL
WSANNHYNMILPLYNKLNPEASASPCCVPQDLEPLTIMYFIGRTPRVEQLSNMVVKSCKC
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgtggctgccccgcctggcactgctgcttctgctccggttctccagtttaccgtcgccg
ggggcggaggggctcaacacgtgtcagtccatcaacttggacgcacagaagtcccggcgc
atcgaggcggtgcggggacagattctcagtaaactccgcatccgcagtcctccaaaagat
gacgaggccccggtgcctggacccgtgccaccggaagtgatgttgctctacaacagtaca
cgagagctgctgaaggagcgcgcgcgccaggccgagtctgcctgcgagcgcgagagcagc
gaagaggattattacgccaaagaggtgcagaggattgacatgctgccaacacgcaccacc
acaaacgctgtgcagccagtagcacccagcccccactacagagtcgtccagttcgacgtc
agtggagtggacttgaccaacagcaccttggtcatggctgagttcagaatcttcagggct
cccaatccccaggcccgggcttcagagcagagagtggagatctatcagctgctgaagcca
gatgaggagagcacctccactcaacgttacatcgactcccgcaccgttcagcccaaagca
aagggatcttggatgtctgtggacgtcacagaaaccgttaaggactggttgtcagatcca
gaaaataatctgggcctaaaactaggtgtccactgtccgtgctgcaccttcgtcccttcc
accaacaacattgttcccaacaagagtgaggagctggaggccctgtttgcaggtgttgac
gacgaaaagattcgccagataagaaaacccggccaggttaaaggtcagccggacgtcagc
accaagacaccacacctcatcctcacactgctgcccagtgacagagtggacaacccagcc
aagaagaaccgcaagaagagggctgcagccacagacgcctccacctgctcccgtggctca
gaccaaggctgctgcctgcgctcgctctacatcgacttcaggcgtgacctcaactggaag
tggatccatgagcctaaaggttacaaagccaacttctgtgctggcaactgtccttacctc
tggagtgccaacaaccattacaacatgatcctgcccctgtacaacaagctgaaccctgag
gcctcagcctcgccctgctgcgttcctcaggacctggagcctctcaccatcatgtatttc
ataggccgcacgccacgtgttgagcaactctccaacatggtggtcaaatcctgcaagtgt
cgctga

DBGET integrated database retrieval system