KEGG   Cynoglossus semilaevis (tongue sole): 103377415
Entry
103377415         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: transcriptional regulator Myc
  KO
K04377  Myc proto-oncogene protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103377415
   04012 ErbB signaling pathway
    103377415
   04310 Wnt signaling pathway
    103377415
   04350 TGF-beta signaling pathway
    103377415
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103377415
   04218 Cellular senescence
    103377415
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103377415
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103377415
   03019 Messenger RNA biogenesis [BR:csem03019]
    103377415
Transcription factors [BR:csem03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    103377415
Messenger RNA biogenesis [BR:csem03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103377415
SSDB
Motif
Pfam: Myc_N Myc-LZ HLH CENP-B_dimeris Nop14 Prothymosin Sporozoite_P67 BSP_II SURF2 PAC1
Other DBs
NCBI-GeneID: 103377415
NCBI-ProteinID: XP_008306447
LinkDB
Position
3
AA seq 448 aa
MPLNSTLTSKNYDYDYDSMQPFFYYDNEEEDFYPQQHQPPAPSEDIWKKFELLPTPPLSP
SRRSSLSSLFPSTADQLEMVTEFLGDDAVNQSIICDADYSKTFLKNIIIQDCMWSGFSAA
AKLEKVVSERLASLHAARKESAALRGGAAAAAVAAADGDSLGSGAGAASAAWRLNSSYLQ
DLNTSASDCIDPSEVFPYPIAETPKQTEGAPSSKDLVLDTPPNSSGSSCSDSEDDDGDGD
EDEEEEEEEEEEEEEEDQEEEEEIDVVTVEKRQAVKRCNPSPVESRHPSPLVLKRCHVST
HQHNYAAHPSMRHEQPAVKRLKLENSSGGGGGGGGGGHSRVLKQISSNRKCLSPRTSDTE
DYDKRRTHNVLERQRRNELKLSFFALRDEIPEVANNEKAAKVVILKKATECIYSMQSDEQ
KLISLKEQLRRRSELLKQRLAQLQGSRA
NT seq 1347 nt   +upstreamnt  +downstreamnt
atgccgctgaattcgactttaacgagtaaaaactatgactacgactacgactccatgcag
ccgtttttctactacgacaacgaggaggaggacttctacccgcagcagcaccagcctccg
gctcccagcgaggacatctggaagaaattcgagctgctgccgacgcctcctctgtccccc
agccgccggtcgtcgctgtccagcctcttcccctccacggcggatcagttggagatggtc
accgagttcctgggcgacgacgcagtcaaccagagcattatctgcgacgcagactactcc
aagaccttcctcaagaacatcatcatccaggactgcatgtggagcggcttctccgccgcg
gccaagctggagaaggtggtctccgagcggctcgcctctctgcacgccgccaggaaggag
tctgcagcgctgcgggggggggcggcggcggctgccgtcgctgctgcagacggggacagt
ctagggtctggagccggcgctgcgtctgcggcgtggaggctgaacagcagctacctgcag
gatctgaacacgtctgcgtcggattgcatcgacccctccgaggtcttcccctaccccatt
gcagagacgcccaagcagacggagggggcgccgtctagtaaagacctggtgctggacacg
ccgcccaacagtagcggcagcagctgcagcgactcagaagatgatgatggagatggagat
gaagatgaggaggaggaagaagaagaagaagaggaggaggaggaagaagaccaggaggaa
gaggaggagattgatgtggtcacagtagaaaagcggcaggcggtcaaacgctgcaacccc
agcccagtggagagcaggcatcccagcccgctcgtgctgaagaggtgccacgtctccacc
caccagcacaactacgccgcccatccatccatgaggcacgagcagccggctgtcaagagg
ctgaagctggagaacagtagtggaggagggggaggcgggggaggcggaggccacagcagg
gtcctcaaacagatcagcagcaaccgcaagtgtctgagcccccggacgtccgacacggag
gactacgacaagagaaggactcacaacgttctggagcgccagcggaggaacgagctcaag
ctgagctttttcgccctgagggacgagattcccgaggtggccaacaacgagaaggcggcc
aaggtggtgatcctgaagaaggccacggagtgcatctacagcatgcagtcggacgaacag
aaactgatctccctcaaggagcagctgaggaggaggagtgaacttttaaagcagagactg
gcacagctgcagggctcccgcgcttaa

KEGG   Cynoglossus semilaevis (tongue sole): 103386756
Entry
103386756         CDS       T04866                                 

Definition
(RefSeq) transcriptional regulator Myc-A-like
  KO
K04377  Myc proto-oncogene protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04012  ErbB signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem05132  Salmonella infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103386756
   04012 ErbB signaling pathway
    103386756
   04310 Wnt signaling pathway
    103386756
   04350 TGF-beta signaling pathway
    103386756
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103386756
   04218 Cellular senescence
    103386756
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103386756
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03000 Transcription factors [BR:csem03000]
    103386756
   03019 Messenger RNA biogenesis [BR:csem03019]
    103386756
Transcription factors [BR:csem03000]
 Eukaryotic type
  Basic helix-loop-helix/leucine zipper (bHLH-ZIP)
   Cell cycle controlling factors, Myc
    103386756
Messenger RNA biogenesis [BR:csem03019]
 Eukaryotic type
  mRNA surveillance and transport factors
   Factors involved in mRNA localization
    Factors that have mRNA localization signals
     103386756
SSDB
Motif
Pfam: HLH Myc_N Myc-LZ Macoilin
Other DBs
NCBI-GeneID: 103386756
NCBI-ProteinID: XP_008319389
UniProt: A0A3P8WUM5
LinkDB
Position
11
AA seq 380 aa
MQSFAQSQDWFCSEPLFMDDEVCLSLMKDIQGLPTPPQSPPMKSTGQGSDKPLSKEDQLS
YVSDILLEDQDMQLNWNCDFFHHLDSAAPCGKECKSRELHCIQLEESGDESLWSCLVTEK
TLDEKLGSSMLGCSPVLSQIDTSIFEEIAGTTLDCQNLMDTPESSEATSDYSSTGGELST
SCSDSEEEIDVVTVVRCPSRLVPLPSLAEVTLQQQQEEQQRVLQRQHIEIQLQHNYAAPC
PASPPPSSNKRSRGNDGSLRFHHSSRSSSSSSSSSSLLSLKYHQHSSRNSAETEDDEERR
RTHNVMERHRRNELKNCFTRLRDNVPEVSHNDKASKVVILKKARDCIYNLEDQAERLQTK
KDKLRARQVALKARLELLRS
NT seq 1143 nt   +upstreamnt  +downstreamnt
atgcagagttttgcccagtctcaagactggttctgttcagagccgctgttcatggacgac
gaggtctgcctgagtttgatgaaagacatacaggggctgcccacgccgccacagtcgccg
cccatgaagagcactgggcaggggtctgacaaacccctctccaaggaagaccagctgagc
tacgtgtccgacattctgctggaagaccaagacatgcagctcaattggaactgtgacttc
tttcaccacctggactctgcagccccctgtgggaaggagtgcaaatcgcgtgaactgcac
tgcatacagctggaggagagcggagatgagagtctgtggagctgcctggtgaccgaaaag
acccttgatgagaagctgggctcctccatgctgggctgcagcccagtgctgtctcagatt
gacaccagcatcttcgaggagatcgccggtaccacgctggactgtcagaatttgatggac
acaccggagagcagtgaggccacgtcagactacagctctactggaggagagctctcaaca
tcatgcagtgactctgaggaagaaattgatgtggtgacggttgtccgctgtccctctcgc
ctcgtccctttgccctcactggctgaggtgaccctgcaacagcaacaggaggagcagcag
cgagtgcttcaacgtcagcacatcgagatccagctgcagcacaactacgccgccccctgt
ccggcttcgccgccgccgtcgtccaacaaacgctccagaggaaacgacggttcgctacgt
ttccaccactcgtctcggagctcctcctcctcctcttcttcctccagcttgttgtcattg
aagtaccaccagcactcatccagaaactccgccgaaacggaggatgatgaggagcggcgg
cggacacacaatgtgatggagaggcatcggcgtaacgagctgaagaactgcttcacccgt
ttgcgcgacaatgtccccgaggtgtcgcacaacgacaaggcttccaaggtggtgatcctg
aagaaggccagggactgtatttacaacttggaggaccaggctgagagactgcagaccaag
aaagacaaactgagagccagacaggtggcgctaaaggctcgtctggagctcctccgaagt
taa

DBGET integrated database retrieval system