KEGG   Cynoglossus semilaevis (tongue sole): 103377650
Entry
103377650         CDS       T04866                                 

Gene name
cntd2
Definition
(RefSeq) cyclin N-terminal domain-containing protein 2 isoform X1
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04114  Oocyte meiosis
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103377650 (cntd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103377650 (cntd2)
   04114 Oocyte meiosis
    103377650 (cntd2)
   04115 p53 signaling pathway
    103377650 (cntd2)
   04218 Cellular senescence
    103377650 (cntd2)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103377650 (cntd2)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csem03032]
    103377650 (cntd2)
   03036 Chromosome and associated proteins [BR:csem03036]
    103377650 (cntd2)
DNA replication proteins [BR:csem03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    103377650 (cntd2)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103377650 (cntd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103377650
NCBI-ProteinID: XP_008306745
LinkDB
Position
4
AA seq 399 aa
MARTGFSDSKPLLDLHKKSCCPPQADERRAPLRTWANACGPVDRWQPAEAEESRMVPVRM
EPDCRWDRSLLMRTSEGIIMGFHEDGGKHSADVEEHMLLYRHGLRGLHSLQTLVPSLLRH
EVETALEKLGLAWDRSYAWDMFLIMMRTQTGNSFPNADLPRHFTDITRAVLVDWLIQVHE
SLHFQDETLYLAIHLVNCSLRQIKVTTVNLQLLGMVCLFLAAKKEECLLPEVSGLCLLMD
HAYTRNQLLRMERKVFSGLKFNLSFCPPLHFLLLFSSVARCSANVVWMAHYLLELSLLEV
QCVVFLPAQLAGAALCLSRKVLQEPLTPEGEAAWCLASSIHVGSETALLRIMHILANAAS
KAHIRETCATFVKFSSPEKMCVSRHPGLKTAHALLGVCT
NT seq 1200 nt   +upstreamnt  +downstreamnt
atggccaggaccggtttctctgactccaagcctctgctggacttacacaagaagtcttgt
tgtcccccccaggcggacgagaggcgagccccgttaagaacttgggccaatgcctgcgga
cctgtggatcgctggcagcctgctgaagcagaagagtccaggatggttcctgtcagaatg
gagccagactgcagatgggatcggagtttattaatgagaaccagtgaaggcatcatcatg
gggttccatgaggacggtgggaaacactcagctgatgtggaggaacacatgcttctgtac
cgccacggcctgcgcggtctccacagcctacagacgctggtacccagcttgctgcgccat
gaggtggagacggctctggagaaactgggccttgcgtgggaccgaagctacgcctgggac
atgtttttgatcatgatgagaactcagacaggtaattcctttcccaacgctgacctcccc
cgccattttacagacatcacccgtgctgtgctggtggactggctcattcaagttcacgag
agcttgcatttccaggatgaaaccctctacctcgccattcaccttgtcaactgctccttg
cgtcagatcaaggtgaccacggtcaatctgcagctcctcggcatggtttgcctcttcctc
gctgcgaagaaagaagagtgtctgctccctgaggtgtccggactctgcctgctgatggac
catgcctacaccaggaatcagctactgcgaatggagcgaaaggtcttctctggactgaag
ttcaacctgtccttctgtcccccacttcacttccttttgctgttttcctccgtcgctcgc
tgcagtgctaatgtggtgtggatggctcactatctgctggagctctctctcctggaggtt
cagtgtgtggtctttctacctgcacagctggcaggagcagcgctctgcttgtcccgcaaa
gtcctgcaggagcccctgaccccagaaggggaggctgcttggtgtctggcctccagtatc
catgtaggcagtgagactgccctgctgaggatcatgcacattctggccaacgctgcatca
aaagctcatatccgagaaacctgtgcaacttttgtcaaattctcctccccggagaagatg
tgcgtcagtagacacccgggtctaaagacggcccatgccctgctgggtgtgtgcacttga

KEGG   Cynoglossus semilaevis (tongue sole): 103379018
Entry
103379018         CDS       T04866                                 

Definition
(RefSeq) G2/mitotic-specific cyclin-B2-like
  KO
K21770  G2/mitotic-specific cyclin-B2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04114  Oocyte meiosis
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103379018
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103379018
   04114 Oocyte meiosis
    103379018
   04115 p53 signaling pathway
    103379018
   04218 Cellular senescence
    103379018
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103379018
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csem03032]
    103379018
   03036 Chromosome and associated proteins [BR:csem03036]
    103379018
DNA replication proteins [BR:csem03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    103379018
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103379018
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103379018
NCBI-ProteinID: XP_008308642
LinkDB
Position
5
AA seq 393 aa
MASLDVRSTRLLGAENPVTKGKPTAADSKRKTVLAELSNCAVAAVNTKRRGAAKASAKPS
CGQKVVSAVVQIKVPGDPVPSVPEEREEEEVDMTINEKQLCQAFSQALLDLQDVDEQDAE
DQYLCSEYVKEIYKYLHELEVQHPIKANYMQGYDITPKMRALLVDWLVQVHLRFQLLQET
LYLTVAVLDRFLQVQPVSRRKLQLVGITAMLVACKYEEMFAPMVGDFAYLTDSAYTVPQI
LKMEQIILQTLSFQLGRPLPLHFLRRASKVAQSNDEKYTLSKYLMELTLLDFNMVHYRPS
EVAAASMCLSQLLLEQLPWSPLQQHYSTYDMGHLKPIMQHIAKNVVMVNERKSEFLAVTK
KYSRPEFLKISLLSQLKSSVIRNMAAPLLSNNP
NT seq 1182 nt   +upstreamnt  +downstreamnt
atggcgtctttggatgttcgttctacgcggctgctaggcgcagagaacccggtgacgaag
ggtaaaccaacagcagctgactcaaagaggaaaactgttctggcagagctcagtaactgt
gctgtagccgcggtgaatacgaagagaagaggtgcagccaaagcctcagccaaaccgtca
tgtggtcagaaagtcgtatcagctgtggtccagatcaaagtgcctggggatcctgtccct
tcagttccagaggagcgggaggaggaggaggtcgacatgaccataaacgagaagcagctg
tgccaggccttctctcaggcgctgcttgacctgcaggacgtggacgagcaggacgctgaa
gatcaatacctgtgttcagaatacgtcaaggagatctacaaatacctgcatgagctggag
gttcagcaccccataaaggccaactacatgcagggctatgacatcacaccaaagatgcgg
gctcttctggtggattggttggttcaggttcaccttcggttccagctgctgcaggagact
ctgtacctcacggttgccgtcctggatcgcttcctgcaggtccaaccagtctctcgcagg
aagctgcagctggttggcatcacggcgatgctggtggcttgtaaatatgaggagatgttc
gctcccatggtgggagactttgcctacctcacagacagcgcctacaccgtgcctcagatt
ttgaagatggagcagatcatcctgcagacgctgtccttccagctgggacgacccctgcca
ctgcacttcctcagacgggcctctaaggtcgcccagtccaacgatgagaagtacactctg
tccaagtacctgatggagctgaccctcctggacttcaacatggtccactaccgcccctct
gaggtggctgctgcctccatgtgtctctcccagcttctgctggaacagctgccgtggtct
cctctacagcagcattactccacctatgacatgggtcacctgaaacctatcatgcaacac
atcgccaagaacgtagtgatggtgaacgaaagaaaatcagaattcctggctgtgacaaag
aaatactccaggccggagttcctgaagatcagtctgctctctcagctgaagtcttcagtc
atcaggaacatggcggctcctttgcttagcaacaacccctga

KEGG   Cynoglossus semilaevis (tongue sole): 103386374
Entry
103386374         CDS       T04866                                 

Gene name
ccnb3
Definition
(RefSeq) G2/mitotic-specific cyclin-B3 isoform X1
  KO
K21771  G2/mitotic-specific cyclin-B3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04218  Cellular senescence
csem04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103386374 (ccnb3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103386374 (ccnb3)
   04218 Cellular senescence
    103386374 (ccnb3)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103386374 (ccnb3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csem03032]
    103386374 (ccnb3)
   03036 Chromosome and associated proteins [BR:csem03036]
    103386374 (ccnb3)
DNA replication proteins [BR:csem03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    103386374 (ccnb3)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103386374 (ccnb3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103386374
NCBI-ProteinID: XP_008318829
LinkDB
Position
1
AA seq 439 aa
MLTFMQEKRSKKDMEPRWEDGQFEEFTDQQLPEPEHGGNAEKTVEIAVEGPQVKRSSSPP
HGAPKKRTAFIDITNAHKVGFNFPGRKKKKEVVKKISSSSSSSSSSSVKRHNNPKTSSVS
SEKEKSDEEETPEVAAAPVEELEVAAPSAVKLVPSHLIRQEIPVEFDIDSENSDDIFMCP
EYAKDIFDYLKRREEKFVLDNYMHKQPTLSTEMRAILVDWLVEVQENFELYHETLYLAVK
LTDQYLSQTVIQREMLQLLGSTCMLIASKLEERSPPCVDDFLYICDDAYKKEELITMECN
ILQTLSFDINIPIPYRFLRRYAKCVNAGMDTLTLARFYCELSLLDMDLVTERGSALASAC
LLMALLSKDLGGWSPILQFHSGYQLSDLAPVVRKLYITLSAPPDEKLKAVRNKYSHKVFF
EVASLPLMKLDVLEKALRQ
NT seq 1320 nt   +upstreamnt  +downstreamnt
atgttgacgttcatgcaggagaagagaagtaaaaaagacatggagccaaggtgggaggat
ggtcagtttgaagaattcactgaccaacagcttcctgagccagaacatggaggaaatgca
gagaaaacggtggaaatcgctgttgaaggtcctcaggtgaagcgctcgtcgtcgccacct
catggagctccaaaaaagaggacggcttttatcgacatcaccaatgctcataaagtcggg
ttcaactttccaggcagaaagaagaaaaaggaggtggtgaaaaagattagctcctcttca
tcctcctcttcctcatcgtctgtaaagagacacaacaaccccaaaacgtcgtctgtgagc
tcagagaaggagaagagtgatgaggaggagacgccagaggtagcagcagcgccagtagaa
gagctggaagttgctgcgccctctgctgttaaacttgtgccatcacatcttatcagacag
gaaattccagtggagtttgacattgactctgaaaactcggacgacatcttcatgtgtccc
gaatacgccaaggacatcttcgactacctcaaacgtagagaggaaaagtttgtccttgac
aactacatgcacaaacagcccactctcagcacagagatgagggccatcctcgttgactgg
ctggtggaggttcaggagaactttgagctgtaccatgagaccctctacctggctgtgaag
ctgacagatcagtatctgtcccagactgtgatccaaagagagatgctgcagctactgggc
tccacctgcatgctcattgcctccaaactagaggaacgcagcccaccatgtgttgatgac
ttcctgtatatctgtgacgacgcatacaagaaggaggagttaatcaccatggagtgcaac
atcctgcagacgttgtcctttgacattaacattcccattccataccggttcctgcggcgc
tatgctaagtgtgtaaatgcaggtatggacacactgactctggctcggttctactgtgag
ctcagtctgctggacatggacctggttacagagaggggttctgcactggcatcagcctgc
ctgctgatggcgctgctcagcaaagacctaggaggatggtctcccattctacagttccac
tctggataccagctgtcagacctggctcctgtagtgaggaaactttacatcacactctca
gctcctcctgacgaaaagctcaaggctgtccgaaacaaatattctcacaaggtattcttt
gaagtggcctctctaccattgatgaagctggacgttctggaaaaggctttacgtcagtga

KEGG   Cynoglossus semilaevis (tongue sole): 103389033
Entry
103389033         CDS       T04866                                 

Gene name
ccnb1
Definition
(RefSeq) G2/mitotic-specific cyclin-B1
  KO
K05868  G2/mitotic-specific cyclin-B1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04114  Oocyte meiosis
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04914  Progesterone-mediated oocyte maturation
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04068 FoxO signaling pathway
    103389033 (ccnb1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103389033 (ccnb1)
   04114 Oocyte meiosis
    103389033 (ccnb1)
   04115 p53 signaling pathway
    103389033 (ccnb1)
   04218 Cellular senescence
    103389033 (ccnb1)
 09150 Organismal Systems
  09152 Endocrine system
   04914 Progesterone-mediated oocyte maturation
    103389033 (ccnb1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:csem03032]
    103389033 (ccnb1)
   03036 Chromosome and associated proteins [BR:csem03036]
    103389033 (ccnb1)
DNA replication proteins [BR:csem03032]
 Eukaryotic type
  DNA Replication Termination Factors
   Prevention of re-replication factors
    103389033 (ccnb1)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Cyclins
    103389033 (ccnb1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103389033
NCBI-ProteinID: XP_008322512
UniProt: A0A3P8WEY3
LinkDB
Position
14
AA seq 400 aa
MALRVTRNRLASTRSDLGGKACTVAGPAKPRAALGEIRNITANGKEAQKKPTMKTKPPRK
IEAEKPAMIEAKEQENVDPIEPEPEVKPEPQSPTPMETSGCEAGDPAELCQAFSDVILNT
VIRDVDADDYDNPMLCSEYVKDIYKYLRQLEAEQSVRPAYLQGREITGNMRAILIDWLVQ
VSLKFRLLQETMYMTVAIIDRFLQDHPVPKKQLQLVGVTAMFLASKFEEMYPPEISDFAY
VTDRAYSTAQIRDMEMNILRVLKFQLGRPHPLQFLRRASKIYEVTAEQHTLAKYLLELTM
VDYEMVHYPPSLLACGAFALTLKVLDSGEWDATLQHYMEYTADTLVPVMKHIAKNVVKVN
EGLTKHMAIKTKYSTSKQMKIATITQLKSPVVKELAKQLQ
NT seq 1203 nt   +upstreamnt  +downstreamnt
atggctctccgtgtcacccgtaaccgattggcttccaccaggtctgacctcggtggaaag
gcctgcaccgtggccgggcctgcgaagcctagggcagcgctgggagaaattcgtaacatc
acagccaacggaaaggaagcccagaaaaagccaaccatgaagacaaagcccccaaggaag
attgaggcagaaaaaccagctatgattgaagcaaaggagcaggagaacgttgatcctatt
gagccagagcctgaggtcaagcctgagccacaatcgccaactcccatggagacttctggc
tgtgaagcaggtgatccagctgagctgtgccaggccttttctgatgtcatcctcaacact
gtgatcagggatgtagacgcagacgactatgacaatccaatgctgtgcagtgaatacgtg
aaggacatctacaagtacctgcggcagcttgaggctgagcagagtgtcagacctgcttac
ctgcagggcagggagatcacgggcaatatgagagctattctgatcgactggctggtacaa
gtgagcctcaagtttcgcctgctgcaggagaccatgtacatgactgtggccatcattgac
cgctttcttcaggaccacccagtccccaagaagcagctgcagctggttggtgtcactgct
atgttcctggcgtctaagtttgaggagatgtatcctccagagatttcagactttgcctac
gtgactgaccgtgcctacagcactgcacagatccgagacatggagatgaacatcctgcgg
gtccttaagttccaactgggtcggcctcaccctctgcagttcctcaggagggcttccaag
atttatgaggtcactgctgagcagcacacactggccaagtacttgctggagctgaccatg
gtggactacgagatggtccactacccaccatcgctcttggcttgtggggcttttgctctg
accctcaaagtgttggattctggagaatgggatgcaacactgcagcactacatggagtac
acggcagacactctggttcctgtgatgaaacatattgccaagaatgttgtgaaagtgaac
gaaggactaacgaagcatatggccatcaaaaccaaatactccacctccaagcagatgaaa
attgccaccattacacagctgaagtcacctgttgtgaaggaactggccaaacagctgcag
tga

DBGET integrated database retrieval system