KEGG   Cynoglossus semilaevis (tongue sole): 103377887Help
Entry
103377887         CDS       T04866                                 

Gene name
wbscr17
Definition
(RefSeq) putative polypeptide N-acetylgalactosaminyltransferase-like protein 3
  KO
K00710  polypeptide N-acetylgalactosaminyltransferase [EC:2.4.1.41]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00512  Mucin type O-glycan biosynthesis
csem01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09107 Glycan biosynthesis and metabolism
   00512 Mucin type O-glycan biosynthesis
    103377887 (wbscr17)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01003 Glycosyltransferases [BR:csem01003]
    103377887 (wbscr17)
Enzymes [BR:csem01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.41  polypeptide N-acetylgalactosaminyltransferase
     103377887 (wbscr17)
Glycosyltransferases [BR:csem01003]
 O-Glycan biosynthesis
  Mucin-type
   103377887 (wbscr17)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Glycos_transf_2 Ricin_B_lectin
Motif
Other DBs
NCBI-GeneID: 103377887
NCBI-ProteinID: XP_008307080
LinkDB All DBs
Position
4
AA seq 530 aa AA seqDB search
SLGDVVYRQLNGLSKSLGLIEGYGGRGKGGVPATLSPAEENEAKNLREKYGYNAYLSDRI
SLDRTIPDHRPSKCRKVSYPRDLPQISLIFIFVNEALSVILRSVHSAVNHTPAHLLKEII
LVDDNSDDEQLKAPLEEYVNKRYPGLVKIVRNQRREGLIRARIEGWKVATAEVTGFFDAH
VEFTPAWAEPVLARIKEDHKRIILPSIDNIKHDTFEVERYENSGHGYNWELWCMYINPPK
QWWDDGDMTAPIRTPAMIGCSFVVNRGYFGELGLLDSGMDVYGGENIELGIRVWLCGGSM
EVLPCSRVAHIARVKKPYHSNIAFHTRRNALRVAEVWMDDYKSNVYLAWNIPMENHGIDY
GDISQRVTLRNSLQCKSFEWYLDNVYPEMRRYNNTLFYGEIRNSAASHLCMDQGVRENHT
ATLHPCHGWGPQLGRYTKEGQLFLGPLGSTGEDTRCVVDDQVNSFPQLLNCEKITNMRQK
SWHFSQNESFINRATGRCLEVVPANVYFGHLLVLQPCSGQKWTIKNTMMQ
NT seq 1593 nt NT seq  +upstreamnt  +downstreamnt
tccctgggggacgtggtgtaccggcagctgaacggtctgtccaaatctttgggcttgatt
gagggctacggtggccggggaaaaggcggcgtccctgccacgctgtctccggctgaggaa
aacgaagccaaaaaccttagagagaagtacggctacaacgcctacctcagcgacaggatc
tctctggaccggaccataccagaccaccggcccagcaaatgtcgaaaggtcagctacccc
agagacctcccacagatttccctgattttcatcttcgtcaacgaggccctgtctgtgatc
ctgcgctcggtccactcggccgtcaatcacacgccggctcacctgctgaaggaaatcatc
ctggtggacgacaacagcgatgacgagcagctgaaagcccccctggaggagtacgtgaac
aagcgctaccctggcttagtgaaaattgtcaggaaccagaggagagagggactgatccga
gccagaatcgaaggttggaaagtcgccacggccgaggtcacgggttttttcgacgcccat
gtggagtttacaccagcgtgggctgagccggtactggccagaataaaagaagaccataag
aggatcatcttgccgtccatcgacaacatcaaacacgacacctttgaggtggagcgctac
gagaactcgggccacggctacaactgggagctgtggtgcatgtacatcaacccgcccaaa
cagtggtgggacgacggcgacatgacggctcccatcagaacccccgccatgatcggctgc
tccttcgtggtcaaccgcggctactttggcgagcttggcctgctggactccggcatggac
gtctacggcggggagaacatcgaactgggcatcagggtgtggctgtgcggcggcagcatg
gaggtgctgccttgttccagagtggctcacatagccagggtgaaaaaaccctaccacagt
aacatcgccttccacacgaggcgcaacgctctacgggtggctgaggtttggatggacgac
tacaaatctaacgtctacctggcctggaacataccgatggagaaccacggtattgactac
ggagacatctctcagcgggtcactctgaggaacagtctgcagtgcaagagcttcgagtgg
tacctggacaatgtttacccggagatgaggaggtacaacaacacgctcttctacggagag
attcgaaattcagcggccagccatctgtgtatggaccagggtgtgagggaaaaccacacg
gccaccctgcacccctgtcatggctggggtccacagctaggacgttacaccaaagaagga
cagctgttcctgggtcctctcggcagcacgggcgaagacacccgctgtgtggtggacgac
caggtcaacagctttcctcagctcctcaactgtgagaagattaccaacatgaggcaaaag
tcctggcatttctcccagaacgagtccttcatcaaccgagccaccggacgctgcctggaa
gtggtgccggccaacgtttacttcggccacctgctggtcctgcagccctgctcggggcag
aagtggaccattaagaacaccatgatgcagtag

DBGET integrated database retrieval system