KEGG   Cynoglossus semilaevis (tongue sole): 103378128Help
Entry
103378128         CDS       T04866                                 

Gene name
htr1e
Definition
(RefSeq) 5-hydroxytryptamine receptor 1E
  KO
K04153  5-hydroxytryptamine receptor 1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04080  Neuroactive ligand-receptor interaction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09133 Signaling molecules and interaction
   04080 Neuroactive ligand-receptor interaction
    103378128 (htr1e)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04030 G protein-coupled receptors [BR:csem04030]
    103378128 (htr1e)
G protein-coupled receptors [BR:csem04030]
 Rhodopsin family
  Biogenic amine
   Serotonin
    103378128 (htr1e)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: 7tm_1 7TM_GPCR_Srsx 7TM_GPCR_Srx 7tm_4
Motif
Other DBs
NCBI-GeneID: 103378128
NCBI-ProteinID: XP_016897439
LinkDB All DBs
Position
1
AA seq 343 aa AA seqDB search
GGVVCQIGLAVVLSVITLATTLSNAFVIAIISQSKKLQTPANFLIASLAVTDLLVSILVM
PICVLYTVIHTWTLGQVVCDIWLSSDITCCTASILHLCVIALDRYWAITDAVEYSKKRTP
GRAAGMVATAWVIAISISLPPLFWRQVKAEELTSCSVNTDHIFYTIYSTFGAFYIPTLLL
IALYGRIYVEARKRILKQSPKKVGKRLTSAHLVTNSPVSVASTASGKHDTLSSDTGSSAS
ENQVKVTVSDALLEKKRISAARERKATKTLGIILGAYIVCWLPFFIYTLVVATCESCFNQ
DLFDFFTWLGYLNSLINPIIYTMSNEDFKKAFHKLVRFRCCRR
NT seq 1032 nt NT seq  +upstreamnt  +downstreamnt
gggggcgtcgtctgccagatcggcctggcggtggttctctctgtcatcacactggccacc
acgttatccaacgccttcgtcatcgctataatctcccagtcgaagaagctccaaactccg
gccaactttctcatcgcctccctggccgtcaccgacctgctggtgtccattctggtgatg
cccatctgcgtcctgtacacggtcatccacacctggaccctgggacaggtcgtctgcgac
atctggctctcgtcggacataacgtgttgcaccgcctccatcctccacctgtgcgtaatt
gccttagacaggtactgggccatcacggacgcggtggaatattccaaaaagcgcacgcca
gggcgcgcagccgggatggtggccacagcctgggtcatcgccatctccatctcgctgcct
cctctcttctggaggcaggtgaaggccgaggagctgaccagctgcagcgtcaacacggac
cacatcttctacaccatctactccaccttcggggctttctacatccccaccctgctgctg
atcgctctctacggacggatttacgtggaggcgcgtaaacgcatcttgaagcagtctccg
aagaaggtggggaagaggctgacctctgcgcacttggtcaccaactcccccgtctcggtg
gcgtccacagcctcggggaaacacgacaccctgtccagcgacaccggctcctcggcgagc
gagaaccaggtgaaggtgacagtgtcggacgcgcttctggagaaaaagcgcatctctgca
gccagggagaggaaagcgaccaaaactttgggaataatcctcggcgcctacatcgtgtgc
tggctgccgtttttcatctacacgctggtggtggcgacatgtgagagctgctttaaccag
gacttatttgacttcttcacctggttgggctacctgaactccctcatcaaccccatcata
tacaccatgtccaacgaggacttcaagaaggcctttcataaactcgtgcgcttcagatgc
tgcagacgctga

DBGET integrated database retrieval system