KEGG   Cynoglossus semilaevis (tongue sole): 103378227
Entry
103378227         CDS       T04866                                 

Gene name
pik3cb
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit beta isoform isoform X1
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103378227 (pik3cb)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103378227 (pik3cb)
   04370 VEGF signaling pathway
    103378227 (pik3cb)
   04068 FoxO signaling pathway
    103378227 (pik3cb)
   04070 Phosphatidylinositol signaling system
    103378227 (pik3cb)
   04150 mTOR signaling pathway
    103378227 (pik3cb)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103378227 (pik3cb)
  09143 Cell growth and death
   04210 Apoptosis
    103378227 (pik3cb)
   04218 Cellular senescence
    103378227 (pik3cb)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103378227 (pik3cb)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103378227 (pik3cb)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103378227 (pik3cb)
   04625 C-type lectin receptor signaling pathway
    103378227 (pik3cb)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103378227 (pik3cb)
   04914 Progesterone-mediated oocyte maturation
    103378227 (pik3cb)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103378227 (pik3cb)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103378227 (pik3cb)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103378227 (pik3cb)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103378227 (pik3cb)
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103378227 (pik3cb)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_p85B PI3K_C2 PI3K_rbd RWD Tom37_C DUF4135
Other DBs
NCBI-GeneID: 103378227
NCBI-ProteinID: XP_008307582
UniProt: A0A3P8VZT4
LinkDB
Position
4
AA seq 1079 aa
MPPAMTDLLDIWVAHSPMLGHTPDQITVDFLLPTGIYIQMDVPREATIQHIKLLLWKQAQ
TLPLFTALGEMESHMFECVNQAAVHEELEDETRRLCDVRPFLPVLKLITRNCGRAERLLD
SKIGVLIGKGLHELDAINDQEVKDFRNKIVRLSEERMQRVCLMTCTEWLQACFSPQLDPG
STTAVTDEVSEQSDLKVIIHFEQSQDSTILKVPSSCTTTELMDLAIKKWLTTHSPEEEAS
RSEYVLRLSQCLEFLCGNHPLSQYKYIRTCMQAKESPSLTMVHMSTIKAMFDKEIKTIGA
VVNHKSLNPLPLPLPPKRRAPTQVQMCVWDLTSTFRIVLVSANKVNADETAKVQVRAGLF
HGTELLCKPVVSSESSQRSDHTWRESTLEFEISVCDLPRMTRLCFAIYAVMDKVKKQKST
KNPHLYKYQTIRKAGKVHFPIAWVNTMVFDYKGHLKTGDINLHCWSSFPDELEEMLNPIG
TVQTNPYTENATALCIHFPEYSSHPVVFPPFDKILEKAAEIVGASDCSPMGRGGKKFYIE
LKEIMERDPLSQLCENEKDLIWTLRCDCRENFPQSLPKLLLSVKWSKHEDMAQLQALLQI
WPKLSPRDALELLDFNYPDQYVREYAVGCLHDMSDDELSQYLLQLVQVLRYEPYYDCALT
HFLLRRAHGNRKIGHFLFWHLRSEIHMPAVSVQFALILEAYCRGSVPHIEVLKKQVDALS
KLKSVNELIKHGNTKNARSKTKEAMLTKEAMMACLKQSGYSETLSDLCSPLNPSVMLSGI
NVEKCRYMDSKMKPLWIVYNNKLLMGDTLGIIFKNGDDLRQDMLTLQILRLMDLLWKESK
LDFRIVPYGCLATGDKAGLIEVVSSADTIANIQLTSSNMAAAAAFNKDALLNWLKERNSG
DALERAIEEFTLSCAGYCVATYVLGIGDRHSDNIMVRSTGQLFHIDFGHILGNFKSKFGI
KRERVPFILTHDFIHVIQQGKTGNTEKFGCFRRYCEEAYLILRNHGNLFITLFALMLTAG
LPELTSVKDIQYLKDSLALGKTDDEALKQFRQKFDEALRESWTTKVNWMAHNVAKDNRS
NT seq 3240 nt   +upstreamnt  +downstreamnt
atgcctcctgccatgacagacctcctggacatatgggtggcccactcaccaatgctggga
cacaccccagaccagattacagtagactttctgctgcctacaggtatttacattcagatg
gatgttccacgagaggccacgattcagcacatcaaactgctcctatggaagcaggcacag
acactgccactcttcaccgcactgggggagatggagagtcacatgtttgagtgtgtcaac
caggctgctgtacatgaagagctggaggatgaaacccgccgactctgtgatgttcgccct
ttcctgccagtcctcaagctaataacgcgcaactgtggccgagcagagcgtttgctggac
tccaaaattggtgttctcattggaaagggccttcatgaactggatgccatcaatgaccag
gaggtgaaggactttcgtaataaaatagttcgtctcagtgaagaaaggatgcaaagagtc
tgtttgatgacatgtactgagtggctgcaggcctgcttctcaccacagttggaccctggt
tctacaacggccgtaactgatgaagtcagtgagcagtctgacctgaaagtcatcatccac
tttgaacagtctcaggactcaaccattctgaaggtgccatcatcatgcactaccacagag
ctaatggacttggccatcaaaaagtggctgaccacccacagcccagaggaggaggcttcc
aggagtgaatatgtgctgagacttagtcagtgtctggagttcctctgtggaaaccaccca
ctgagtcaatacaagtatattcgcacatgcatgcaggccaaggagtctcccagcctcacc
atggtccacatgagcaccatcaaagctatgtttgataaggaaattaaaaccattggagca
gttgttaaccacaagtctttaaacccactacctttaccattaccacctaaaagaagagct
cccacgcaggtgcagatgtgtgtgtgggatttgaccagtacctttaggatagtccttgtg
agtgccaataaggtgaatgcagacgaaactgcaaaggtccaagtcagggccgggctcttc
cacggcacagaactgttgtgcaagccggtggtgagcagtgagagcagccagcgctcggat
cacacttggagggaaagcacactggaatttgagatctctgtttgtgatctaccacgtatg
acccgcctctgctttgccatatatgccgtcatggataaggtgaagaagcagaagtcgacc
aaaaacccacacctgtataagtaccagaccattcgcaaagcagggaaagtgcacttccct
atagcttgggtgaacaccatggtgtttgactacaaaggccatttaaagacgggagacatc
aacctccactgctggtcttcctttcctgatgaacttgaagagatgctgaaccccatagga
accgttcagaccaacccgtacactgagaacgccacggctctgtgcattcactttccagag
tattcctcacaccctgttgtcttccctccctttgacaaaatactggaaaaagctgcagag
attgtaggagcaagtgactgttcaccaatgggtcgtggtggaaagaagttctacatcgaa
ctgaaggagatcatggagcgtgaccctctgtctcagctatgtgagaacgagaaggatttg
atatggacactacgctgtgactgtcgagagaatttcccacagtcgctgcctaagttgctg
ctctctgtcaagtggagcaaacatgaggacatggcccagctccaagcccttctacagatt
tggcccaaactgagtcccagagatgctctggagctcctggactttaactacccagaccag
tatgttagagaatatgctgtgggctgtttgcatgatatgagtgatgatgagctgtcccag
tacctgctacagttagtgcaggtgttgcggtatgaaccatattatgattgtgccctcacc
catttcctgctgcggcgtgcccacggaaaccgcaaaattggacactttctcttctggcac
ttacggtcagagatccacatgccagcggtttcggtccagtttgcactaatcctcgaggcc
tactgcaggggcagcgttcctcatattgaagttctaaagaaacaggtggatgctctgagt
aaactaaagtctgtcaatgagctaataaagcacggcaacaccaaaaatgcccggagtaag
accaaggaagccatgttgacaaaagaagccatgatggcctgcctgaaacaaagtggttat
tcagagacgctgtctgacctgtgctctcctcttaaccccagcgtcatgctgtctggcatc
aatgtagagaagtgtcggtacatggactctaagatgaagcccctgtggattgtttacaac
aacaagctgttgatgggagacactttgggaatcatcttcaagaacggtgatgacctgaga
caagacatgttaacgctacagattctgaggttgatggatctgctgtggaaggagtctaag
ttggacttcagaatcgtgccatacggttgtcttgcaactggcgacaaagcagggctgatt
gaggtcgtttcatcggcggacaccattgccaacatccagttgacaagcagtaacatggcg
gcagctgctgccttcaacaaggacgctttgctaaactggctgaaagagaggaactctggt
gatgctcttgagcgtgccatcgaggagttcactctgtcctgtgcaggctactgtgtggcc
acctacgtgctgggcatcggagaccgccacagtgacaacatcatggtccgcagcactgga
cagctctttcacattgacttcggtcacatcctgggcaacttcaagtctaagtttggcatc
aagagggagcgtgtacctttcatacttacacacgacttcattcacgtcattcagcagggc
aagacagggaacacagagaagttcggctgctttcgtcggtattgtgaggaggcctattta
atcctgagaaatcatgggaatctcttcatcactctttttgccctcatgttgacagctggg
ctgcctgaactcacctcagtcaaggacatccagtacctgaaggattccttagctcttggt
aaaacagatgatgaggccttgaagcagtttcggcagaagtttgacgaggccctgagagag
agctggactaccaaagttaactggatggcccacaatgtagccaaagacaaccggtcgtaa

KEGG   Cynoglossus semilaevis (tongue sole): 103385041
Entry
103385041         CDS       T04866                                 

Gene name
pik3cd
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit delta isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103385041 (pik3cd)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103385041 (pik3cd)
   04370 VEGF signaling pathway
    103385041 (pik3cd)
   04068 FoxO signaling pathway
    103385041 (pik3cd)
   04070 Phosphatidylinositol signaling system
    103385041 (pik3cd)
   04150 mTOR signaling pathway
    103385041 (pik3cd)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103385041 (pik3cd)
  09143 Cell growth and death
   04210 Apoptosis
    103385041 (pik3cd)
   04218 Cellular senescence
    103385041 (pik3cd)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103385041 (pik3cd)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103385041 (pik3cd)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103385041 (pik3cd)
   04625 C-type lectin receptor signaling pathway
    103385041 (pik3cd)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103385041 (pik3cd)
   04914 Progesterone-mediated oocyte maturation
    103385041 (pik3cd)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103385041 (pik3cd)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103385041 (pik3cd)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103385041 (pik3cd)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103385041 (pik3cd)
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103385041 (pik3cd)
SSDB
Motif
Pfam: PI3_PI4_kinase PI3Ka PI3K_p85B PI3K_rbd PI3K_C2 DIRP DUF4135
Other DBs
NCBI-GeneID: 103385041
NCBI-ProteinID: XP_008317024
LinkDB
Position
10
AA seq 1036 aa
MPPGKYGMQEEWEKEGVQEIVMDFLLPTGIFLKFPVSRNDTIKNIKKMVWRNARSEALFS
ALGDPDAYVFTCINQTAEREELEEESRRISDVQPFMCVLRLVAREGDRVEKLTNAQISLL
IGKGLHEFEAQKNHEVNEFRLKMRTFCEDKALEQQRLPWQQWMEYSFPTDLEPCGSPPQK
SKNIKKIFIIVKFEACDESFMLQQNPQDNPGALIRSALKKKATVFRSMRQEPEDYTLQVN
GRWEFIYGKHPLCQFKYIFSCLTNGQNPHLIMVHRSTISKYQEEQGRMCSQVFKSHSSSR
PPPLPLKKCTSSLWSINEPFCVQLLQGIRVNADEGMKLVVQAGLFHGSELLCKIVTSSEV
TVCSEPLWDQKLNFDINVADLPRMSRLCFALYAVIEKNKKPRGTKKKNKKADCPIAWVNT
MVFDYKDQLKTGEVILSMWPSVPGTVHHLLXPMGTVEKNPNLDSAAGLLIRFPNIRPHPL
YYPALDKISEVETNGDIAHVTKEEHMKLKEIMDNKNYTEFFEDEKELLWKLRAEVRNHYP
ESLSKLLQITKWNKREDVVQMVSLLRNWPDLPAIQALELLDYSFPEPAVRYFTIRCLRML
SDDELLQYLIQLVQVLKYESYLDCDLTTFLLERALSNKRIGHFLFWHLKSEMHVPSVTLR
FGLILEAYCRGNIHHIKLLSKQNEALGKMKALSDFVKSGSQKLTAEDLKMCIRQESYLEA
LSDILSPLNPSIILTEICADKCRFMDSKMKPLWLMYKNNLSQGDMVGIIFKNGDDLRQDM
LTLQMIQLMETLWKKEGLDLRMIPYGCLSTGNKMGLIEVVKNSDTIANIQRNNSNSAATA
AFNKDALLNWLKSKNPEDKLDQAIEEFTLSCAGYCVATYVLGIGDRHNDNIMIRETGQLF
HIDFGHFLGNFKRKLGINRERVPFILTYDFVHVIQEGRTNNSEKFERFREYCERAYKILC
RNGTLFVNLFAMMKAAGLPELTSFKDIQYLKDSLALGKTEEEALKNFKVKFNEALRESWK
TKVNWMMHSLAKDNRP
NT seq 3111 nt   +upstreamnt  +downstreamnt
atgcccccagggaagtatgggatgcaggaggaatgggagaaggagggcgtccaggagata
gtgatggacttcctgttgccgactgggatcttcctcaaattccctgtgtctcggaacgac
accatcaagaacatcaaaaaaatggtttggagaaatgcgagaagcgaggccctcttcagt
gccctgggagatcctgacgcatacgtcttcacctgcatcaaccagacggcagagcgtgag
gaactggaggaggaatcgaggcggatcagtgatgtgcagcctttcatgtgtgttctgagg
ctggtggccagagagggcgaccgagtggagaaactcaccaacgcacaaatcagcctgctg
atcggcaaaggccttcatgagtttgaggcccagaaaaaccatgaagtgaatgagtttcgg
ctaaagatgagaacattttgcgaggataaggctctggagcagcagaggttgccatggcag
cagtggatggagtacagttttcccactgacctggagccgtgcggctcacctccacaaaag
tccaaaaacatcaagaagattttcatcatcgtcaagtttgaggcgtgcgatgaaagcttc
atgctgcagcagaatcctcaggacaaccctggggctctgatacggagcgctctgaagaag
aaggccaccgtcttccgctcaatgcggcaggagcccgaggattacactttacaggtcaac
gggaggtgggagttcatttatgggaaacatccactgtgtcagttcaagtacattttctca
tgtttgacaaatggccagaaccctcatctaatcatggtgcaccgctccaccatcagcaag
taccaggaggaacagggtaggatgtgcagccaggtgttcaagagtcactcctcatccaga
cctcctccactgcctctgaagaagtgcacgtcctctctgtggtccatcaatgagccattc
tgcgttcagctgctgcagggcatccgtgtcaacgcagatgagggaatgaagctcgtagta
caagcgggtctgttccatggcagcgaactgctgtgtaagatagtgaccagttccgaggtg
acggtttgttctgagcccctctgggatcagaaactgaactttgacataaacgtggctgac
ctgcctcgaatgagccgtctttgtttcgcactctacgccgtcattgagaaaaacaagaaa
ccccggggcacaaaaaagaagaacaagaaggcggactgccccatcgcctgggtgaacacc
atggtgtttgactataaggaccagctcaagactggagaagtcatcttgtccatgtggcca
tctgttcctggtactgttcaccatctcctnnncccaatgggaacagttgagaaaaaccct
aatttagacagcgctgcaggacttcttattcgtttccccaatatccggccacaccctctt
tattacccagcgctggacaagatcagtgaggttgaaacaaatggtgatatagctcatgtc
accaaagaagagcacatgaaactgaaggagatcatggacaacaaaaactacacagagttc
tttgaggacgagaaggaactgctgtggaagctccgtgccgaggttcgcaaccattatcca
gagagtttgtccaagctgctccaaatcaccaagtggaataaacgagaagatgtagttcag
atggtgagtctgctgaggaactggccagacctccctgccatccaggcactagaactcctg
gactacagttttcctgagcctgccgttcgttacttcactatcagatgcctccgaatgctc
agtgacgatgagctgctgcagtatctaattcaactggtccaggtcttgaagtacgagtcc
tacctggactgtgacctcaccactttcctacttgagagagcgctgtctaacaagaggata
ggacactttctgttttggcatctgaagtcagagatgcatgtgccatctgtgactctgcgg
tttggcctaattttggaagcctactgcaggggaaacatccaccacataaaactcttgtcc
aaacagaacgaggctctgggtaaaatgaaggccctgagtgactttgtcaaatcaggttct
cagaagttgacagcagaggacctgaagatgtgtatcagacaagagtcctacctggaggct
ctgtccgacattctgtcaccactcaaccccagcatcatcctgactgagatctgtgcagac
aagtgcagattcatggactccaaaatgaagcctctgtggttgatgtacaagaacaactta
tctcaaggagacatggtgggaatcatcttcaagaatggagatgatctgcgacaagacatg
ttgaccctccagatgatccagctcatggagacattgtggaagaaagaaggtcttgacctc
aggatgatcccatacggctgcctgtctactggaaacaagatggggctcattgaagtggtg
aagaactctgacaccattgctaatattcagcggaacaacagcaacagtgccgccactgct
gccttcaacaaggacgctctgctcaactggctcaagtctaagaatcctgaagacaaactt
gatcaagcaatagaagagttcacgctgtcctgtgctggctactgtgtagctacttatgtg
ttgggcatcggagatcggcacaacgacaacatcatgatcagggagacaggacagctgttt
cacattgactttggacatttcctgggcaactttaaacggaagcttgggatcaacagggag
cgtgtgcctttcatcctgacttatgactttgtccatgtgatccaggagggccggacaaac
aacagcgagaagtttgagagattcagggagtactgtgagcgagcctacaagatcctatgt
aggaacggcacactgtttgtgaacctctttgctatgatgaaagcagcaggactgcctgag
ctcacctcctttaaagacatccagtatctgaaggattctttagctctgggcaaaacagag
gaagaggctctgaagaatttcaaagtaaagtttaatgaagcactgagagaaagctggaag
accaaggtcaactggatgatgcactctttggccaaagataatagaccgtga

KEGG   Cynoglossus semilaevis (tongue sole): 103390039
Entry
103390039         CDS       T04866                                 

Gene name
pik3r1
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103390039 (pik3r1)
   04370 VEGF signaling pathway
    103390039 (pik3r1)
   04068 FoxO signaling pathway
    103390039 (pik3r1)
   04070 Phosphatidylinositol signaling system
    103390039 (pik3r1)
   04150 mTOR signaling pathway
    103390039 (pik3r1)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103390039 (pik3r1)
  09143 Cell growth and death
   04210 Apoptosis
    103390039 (pik3r1)
   04218 Cellular senescence
    103390039 (pik3r1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103390039 (pik3r1)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103390039 (pik3r1)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103390039 (pik3r1)
   04625 C-type lectin receptor signaling pathway
    103390039 (pik3r1)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103390039 (pik3r1)
   04914 Progesterone-mediated oocyte maturation
    103390039 (pik3r1)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103390039 (pik3r1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103390039 (pik3r1)
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103390039 (pik3r1)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 SH3_2 SH3_9 Laminin_I BRE1
Other DBs
NCBI-GeneID: 103390039
NCBI-ProteinID: XP_008323951
UniProt: A0A3P8W5A2
LinkDB
Position
14
AA seq 726 aa
MSAEGYQYRALYDYKKEREEDIDLHVGDILLVSKGALMALGYTEGQEQRSEEIGWLPGLN
ETTQEKGDFPGTYVEYIGKKWISPPTPKPRPIRPLPVAPGSYKAEDSDSEQGCLLDLTEQ
FSLPDTAPPMLVKLLETIEKKGLDSPTLYRTFTAGAGYEVRQLFECDLPTADLDQFDLPV
LCDGLRRYLQDLPQPIIHSAIHAQMVLTVKEVVNSEECAQLLRRISSTPSLPPQYWLTLH
CLLRHFARVCENGSKNLLTARALGEIFSPIFFRQQTTSCEPSLDSHIKIIELLVTSEWNE
TQAAPALPPKPPKPTSVMSNGLNNNMALQDAEWYWGDISREEVNEKLRDTADGTFLVRDA
STKMHGDYTLTLRKGGNNKLIKIFHRDGKYGFSDPLTFSSVVELINHYRNESLAQYNPKL
DVKLLYPVSKHQQDQVVKEDNIEAVGRKLCEYHQQYQEKNKEYDRLYEEYTRTSQEIQMK
RTAIEAFNETIKIFEEQCQTQERYSKEYIEKFRREGNDKEIQRIMGNYEKLKSRIIEIVD
SKRRLEEDLKKQAADYREIDKRMNSIKPDLIQLRKTRDQYLMWLTQKGVRQKKLNEWLGI
KNENTEDQYSMVDDDEDLPHHEERSWKLGNINRLQAEALLQGKRDGTFLVRDSSKAGCYA
CSVVVEGEVKHCVINKTPSGYGFAEPYNLYSSLKELVLHYQHTSLVQHNDSLNVTLAYPV
YAQQRR
NT seq 2181 nt   +upstreamnt  +downstreamnt
atgagtgctgaaggatatcagtatagagcgctgtatgactacaagaaggagagggaggag
gacattgatctgcatgtgggagacattctattggtgagcaaaggtgctctgatggctctt
ggttacacagagggacaggagcagaggtcagaggagattggctggctgccaggccttaat
gaaaccactcaggaaaagggggacttccctgggacgtatgttgagtacataggaaagaag
tggatatctcctcccacacccaagccaaggcccatcagacccttacctgttgcaccaggt
tcctacaaagcagaggactctgactctgaacaaggttgtttgttggacttgactgaacag
ttttcacttcctgacactgctccaccaatgttggtcaagctgctggaaactattgagaaa
aaaggtcttgatagccccactctgtatcgaacatttacagctggtgctggatatgaagtc
aggcaactctttgaatgtgatcttcccacagcagatctggatcagtttgatcttcccgtc
ctttgtgatggtctgcgcaggtacctacaggatcttccacagcccatcatacactctgca
atacatgctcagatggtcctcacggtcaaagaagtggtaaatagtgaagaatgtgcccag
ctgctacgtcgtatctccagcaccccgagtctgcctccccaatactggctaacgctgcac
tgtctgttaagacatttcgctagagtctgtgaaaatggctccaagaacctgcttacagca
agagccctgggcgagatcttcagtcctatatttttcagacagcaaaccaccagttgtgaa
cccagtctggattctcacatcaagatcattgagcttctggtgaccagtgaatggaatgaa
actcaggctgctccagctctacctcctaagccacccaagcccacatctgtgatgagcaac
ggtttgaataataacatggctctgcaagacgccgaatggtactggggcgacatatcaagg
gaggaggtcaatgagaaactgagggacactgcggatggtacattcttggtgcgtgatgcc
tccaccaaaatgcacggagattacaccctgactctgaggaaaggaggtaacaacaaactc
attaaaatattccatcgagacgggaagtacggcttctcagatccactgacctttagctcc
gttgtcgagctcatcaaccactatcgcaatgagtcactggctcagtacaaccccaagttg
gacgtcaaactgctgtatcctgtctctaaacaccagcaggatcaggtggtgaaagaagac
aacattgaagccgttggtagaaaactctgtgagtaccaccaacaataccaggaaaagaac
aaagagtacgaccgactgtatgaagaatacaccagaacttcacaagaaatccaaatgaag
aggacagccatagaggcgttcaacgaaaccataaagatctttgaggagcagtgtcaaaca
caagagcggtacagcaaggagtatattgagaaatttaggagggagggcaatgacaaggag
atccaaaggatcatgggaaactatgaaaagttgaaatcaaggataattgaaattgtagac
agcaaacgtcgcctggaagaagacctaaagaaacaggcagctgactacagggagatcgac
aagaggatgaacagcatcaagcccgacctcatccagctgcgcaagaccagagaccagtat
ctcatgtggttgacccaaaaaggagtgagacagaagaaactcaacgagtggcttggaatc
aaaaacgagaacacagaagatcaatattctatggtggatgatgatgaagacctgcctcat
catgaagagcgctcctggaaactgggcaacattaaccgactgcaggcggaggcgctcctc
caggggaagagagatggaacattcctggttagagacagcagcaaggcgggatgctacgcc
tgtagtgttgttgtggaaggtgaggtgaagcactgcgtcatcaacaagactccctcaggt
tatggctttgccgagccttacaacctgtacagctccctaaaagaactcgtacttcactac
cagcacacatctttggtccagcacaatgactctctgaatgtgacgctagcgtatcccgtg
tacgcccagcagagacggtga

KEGG   Cynoglossus semilaevis (tongue sole): 103394768
Entry
103394768         CDS       T04866                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103394768
   04370 VEGF signaling pathway
    103394768
   04068 FoxO signaling pathway
    103394768
   04070 Phosphatidylinositol signaling system
    103394768
   04150 mTOR signaling pathway
    103394768
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103394768
  09143 Cell growth and death
   04210 Apoptosis
    103394768
   04218 Cellular senescence
    103394768
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103394768
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103394768
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103394768
   04625 C-type lectin receptor signaling pathway
    103394768
  09152 Endocrine system
   04910 Insulin signaling pathway
    103394768
   04914 Progesterone-mediated oocyte maturation
    103394768
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103394768
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103394768
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103394768
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 DUF4407 FadA DUF948 UPF0449 SPACA9 DUF4164
Other DBs
NCBI-GeneID: 103394768
NCBI-ProteinID: XP_008330428
UniProt: A0A3P8WHP4
LinkDB
Position
2
AA seq 408 aa
MASRDSNDNDIQLLDAEWYWGSISREEVSEVLRNTPEGTFLVRDSTSRVKGEYTLTLRKD
GSNKLIKIFHHGGKYGFSEPLVFPSVMNLIQYYQSQSLALYNSKLDTRLLYPLSRYQQQA
VFEVGSDAIEEQLRQFQDQYKEKSKEYDHLFEELNQTSQDLQSKCTAIEAFGEIIRLFEE
ECETQERYSKEYINMFLSLQNKTETYKIERNTDKLQSRVEEVHNSKSKLEDELKKEVLDH
MDVDRKTDGLKKEPAELRTLRDQYLLWLTQHGSKPGQMTDWSGVKNEDEEDDLYTLVDDA
KQEACTWYVGDMGRKEAEELLRGKRDGTFLIRDSQSQKGCFACSVVLNGDVKHCVIYRTS
NGFGFAEPYNLYPTLKDLVLHYRDTSLVQHNQQLNVTLAWPVLSEQPN
NT seq 1227 nt   +upstreamnt  +downstreamnt
atggcatcgcgtgattccaatgacaatgacattcaactactggatgcagagtggtactgg
ggcagcatctcaagagaggaagtaagtgaggtgctaagaaacactcctgaaggtacattc
ctggtccgagattctaccagtcgggttaagggtgaatatactctcacattaaggaaagat
ggttccaacaaattaataaagatttttcatcacgggggcaaatacggcttctctgagcca
ctcgttttcccttctgtgatgaacttaatccagtattaccagagccaatcacttgccctg
tacaactctaaactggacacacgactgctctaccctctgtccaggtaccagcagcaggct
gtgtttgaagttggcagtgatgcaattgaagaacagctgagacaatttcaggatcaatat
aaagagaaaagcaaagagtatgaccatctgtttgaggagttaaatcaaacatcccaggac
ctgcaaagcaagtgcacagccatagaggcttttggtgaaattattcggctctttgaagag
gagtgtgaaactcaagaacgatacagcaaagaatatattaatatgttcttatcgctacaa
aacaaaacagaaacctacaagatagaaagaaacactgacaagctgcagtcaagggtcgag
gaggtccacaacagtaaaagtaaattggaggacgagctaaaaaaagaggtgctggatcac
atggatgttgacaggaaaactgatggtctaaagaaggagcctgcagagctcagaactttg
agagatcaatacctgctctggctcacacagcatggttctaagccaggtcaaatgaccgac
tggtcaggagtcaagaatgaagacgaggaagacgacctgtataccctcgtggatgatgca
aagcaggaggcatgtacctggtatgtaggtgatatgggacggaaggaggcagaggagctg
ctaagagggaaaagggatggaaccttcttaatcagagacagtcagtctcagaaaggatgt
tttgcctgctctgttgtattgaatggagatgtaaagcactgtgtgatctacagaacttca
aatggatttggttttgcagagccttataacttgtacccaacactgaaagacctggttctc
cactacagagacacctctcttgtgcaacacaatcagcagctcaatgtaaccctggcatgg
cctgttcttagtgagcaacccaactga

KEGG   Cynoglossus semilaevis (tongue sole): 103395817
Entry
103395817         CDS       T04866                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103395817
   04370 VEGF signaling pathway
    103395817
   04068 FoxO signaling pathway
    103395817
   04070 Phosphatidylinositol signaling system
    103395817
   04150 mTOR signaling pathway
    103395817
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103395817
  09143 Cell growth and death
   04210 Apoptosis
    103395817
   04218 Cellular senescence
    103395817
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103395817
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103395817
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103395817
   04625 C-type lectin receptor signaling pathway
    103395817
  09152 Endocrine system
   04910 Insulin signaling pathway
    103395817
   04914 Progesterone-mediated oocyte maturation
    103395817
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103395817
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103395817
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103395817
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 Ribosomal_L22e
Other DBs
NCBI-GeneID: 103395817
NCBI-ProteinID: XP_008331834
UniProt: A0A3P8VRS4
LinkDB
Position
20
AA seq 467 aa
MVYPPDGLFYIEMDQAPPALPARSSKPVSSTMNNNCPSPPAYSLQDAEWYWGDITREEVN
EKLRDTPDGSFLVRDASTKLQGDFTLTLRKDGHNKLIKIYHHDGKYGFSDPLTFTSVVEL
IWYYQHHPLVEYNATLDLMLTHPVSRFQQVKEDSVDMAGRKLKEVHNRYEEKSREFDCLY
KVFTKTSQEIQMKRTAIEAFNETMLIFEEQCREQERYGEEYERNNQPEALETDLESFLIN
YEKLKCRLVEIYDSKIHLEEDLRTQVEDYRETDRKMNSLRPDLIQLRNIRDQYLNWLNHK
GVRQKRINDWLGIQSDSLDDTYVLKGDEKNLPHQDETSWLVGEMSRTQAEEMLQGKVPGT
FLIRESSKQGCYACSVVVDKEVKHCMIYSTPHGYGFAEPYDVHCSLKELVLHYRLHSLAQ
HNDALDVRLSHPVNAKAASSPSQHIEDHKLLQTPKHTAGLPPAAPEM
NT seq 1404 nt   +upstreamnt  +downstreamnt
atggtttatcctcccgacggtctattctacatcgaaatggatcaagcaccaccagctctc
cctgccaggtcatcaaagccagtgtcttccaccatgaacaacaactgcccgtcccctcct
gcatattcactgcaggacgctgaatggtactggggagacatcaccagggaagaggtaaac
gagaagctccgagacacacctgacggctccttcctggtccgtgacgcatcgacgaagctg
cagggagacttcacgttaacgttgagaaaagacggccacaacaagttgatcaaaatttac
caccatgacggcaagtacggcttctcggaccctctcacgttcacttcggtggtggagctg
atctggtattatcaacaccatccgctggtggagtacaacgccacactggatctgatgctg
acccatcctgtctcccgcttccagcaggtcaaagaagacagcgtggatatggctgggagg
aagctgaaggaggttcataatcggtatgaagagaaatccagagagtttgactgtctgtac
aaagtcttcacaaagacctcacaggaaatacaaatgaagagaacagcaattgaggctttt
aatgagacaatgctgatctttgaggagcagtgtcgtgagcaggagcgctacggcgaggaa
tacgagaggaacaatcagcccgaagccctcgaaacagatctcgaaagctttctcataaat
tatgaaaagctcaagtgccgactcgtggagatctacgacagcaagattcacctggaggaa
gacttgagaacgcaagtggaggactacagagagacggacaggaagatgaacagcttaagg
cctgacctcatccagctacgcaacattagagaccagtatttgaactggcttaatcacaaa
ggtgtacggcagaaacgcataaatgactggctgggcatacagagtgacagccttgacgac
acatacgtactaaagggggatgaaaagaatttgccccatcaagatgagacaagttggtta
gttggagaaatgagtaggacacaggctgaggagatgcttcaaggaaaagttcctggaacg
ttcctgatccgcgaaagcagcaaacagggatgttacgcctgctctgttgtggtggacaag
gaagtgaagcattgcatgatctacagcacaccgcacggatacggcttcgccgagccgtac
gacgtccactgctcgctgaaagagctcgttctgcactatcgcctgcactctttagctcaa
cacaacgacgccctggatgttcggctgtcgcatccagtgaacgccaaagctgcatcctca
ccttctcagcatatagaggatcacaaactcttacaaactccaaaacacacagcagggctt
ccacctgccgcaccagaaatgtaa

KEGG   Cynoglossus semilaevis (tongue sole): 103395882
Entry
103395882         CDS       T04866                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103395882
   04370 VEGF signaling pathway
    103395882
   04068 FoxO signaling pathway
    103395882
   04070 Phosphatidylinositol signaling system
    103395882
   04150 mTOR signaling pathway
    103395882
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103395882
  09143 Cell growth and death
   04210 Apoptosis
    103395882
   04218 Cellular senescence
    103395882
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103395882
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103395882
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103395882
   04625 C-type lectin receptor signaling pathway
    103395882
  09152 Endocrine system
   04910 Insulin signaling pathway
    103395882
   04914 Progesterone-mediated oocyte maturation
    103395882
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103395882
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103395882
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103395882
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_9 SH3_1 SKA2 Ribosomal_L22e DUF4188 V_ATPase_I
Other DBs
NCBI-GeneID: 103395882
NCBI-ProteinID: XP_008331935
UniProt: A0A3P8W0J7
LinkDB
Position
20
AA seq 734 aa
MAAEDFQYRALYSFTKDQEEDLDLQPGDLLLVSKATLSSTENYQEGCEERPECLGWLLGY
NERTKQRGDFPGTYVEYVGPVKPVLPSSQPRSQRPLPAAPRPEFSQAVSVLDLSEQFTPP
ETAPPALVSLIQAIEKRGLDSKTLYRTVGSPGAESPGCTLSTESEAGQKDIGYLSECVLH
YLRELPSPVIPACIYPHLQTVATLQQQGLQQSAEGAVAASHDREVSLVLERSTNIPLHNR
LTLQYLLTHLAKVTQANNGLDSHTLGNIFGPLIIRTSPTSSGSSFDEEFPALVMERLLIE
RTTEQNLTPPDLPAKPSKSKMTPSAMTDTSGMLTEAEWYWGEISREEVNEKMKDTPDGTF
LVRDASSKLEGEYTLTLRKGGNNKLIKIYHRDGRYGFSEPLTFLSVVELINHYRHESLAQ
YNAKLDTKLFYPVSKYQQLVKENSIEEVGEALKVYHEQYQEKSREYDCLYEEYTRTSQEL
QMKRTAIEAFNETIKIFEEQFETQERFSRESLEQFEREGNEKEIQKIQSNSERLKSRVKE
IHDSKRKLEQDLRHQVSDNREIDKKMNSLKPDLMQLRKMRDQYLIWLTQKGTRQKKINEW
LGIKNDADDSYSLEDDEGSPHHDECTWYVGDIKRSQAEDMLRGKCDGTFLIRESQSQKGS
YACSVVVDGYTKHCVVYKTATGYGFAEPYNLYSSLKDLVLHYKNVSLVQHNDHLNVNLAY
PVLACSQNQNQHPR
NT seq 2205 nt   +upstreamnt  +downstreamnt
atggcagcagaggattttcagtaccgtgctctctactcattcaccaaggaccaggaggag
gacttggacctgcaacctggtgatctcctcctagtcagcaaggccactctgtcgtccact
gagaactaccaggagggatgcgaggagcgaccagagtgtctgggctggctcctcgggtac
aacgagcgcactaagcaaagaggtgacttcccagggacctatgttgaatacgttggccca
gtcaaaccagtgctcccatctagtcaacctaggtcacaacgaccacttcctgctgctcca
agaccagaattctctcaagctgtttctgtcctggacctgagtgagcagttcacaccacca
gagacggctcctccagctctggtcagcctgatccaagccatagagaagagaggtctggat
tccaagaccttgtacaggacagtaggctccccaggagcagaaagtccagggtgcaccctc
agcacagagagcgaagctggtcaaaaagacattggttacctctctgagtgtgtcctgcac
tacctgagagagcttccttcacctgtcatccctgcctgtatctaccctcaccttcagact
gttgccacactgcagcagcagggcctacaacagtcagcagaaggagctgtagctgcgagc
catgacagagaggtcagcctcgtcctcgagcgctccaccaacatccctctccacaaccgt
ctcaccctgcagtacctcctcacacacctggccaaggtcacgcaggccaacaatggtcta
gactcacacacactgggaaacatatttggaccactgatcatacggactagccccacatca
tctggctcatcatttgatgaggagtttcctgctcttgtgatggagaggttgttaatagaa
agaacaacggagcagaacctcacacctccagatcttcctgccaagccatccaagtcaaaa
atgacaccatctgccatgacagacacaagcggcatgctgaccgaggctgagtggtactgg
ggagaaatctccagagaggaggtgaacgagaagatgaaagacactccggatggcaccttc
ctggtccgggatgcttccagtaaactagagggcgagtacacactcaccctgaggaaagga
ggaaacaacaagctcataaagatttaccacagagatgggaggtacggtttctctgagcct
ctcacatttctgtctgtagtggagctaatcaatcactaccggcatgagtccctggcccaa
tacaacgccaaactggacaccaagcttttttaccctgtctccaaataccagcagctggtg
aaagagaacagcatagaggaagtgggagaagctctgaaggtttatcatgagcagtatcag
gagaagagccgggagtacgactgcctgtatgaggaatacacccgcacttctcaggagctg
cagatgaaacgtacggccattgaggcattcaatgagaccatcaagatttttgaggagcag
tttgagactcaggagcgcttcagccgagaatcgctggagcagtttgagcgtgaaggcaac
gagaaggagatccaaaagattcagagcaattcagagcgcttgaagtcccgcgtgaaggaa
atccacgacagcaagcgcaaactggagcaggatctgcgacaccaggtctccgacaacaga
gagattgacaagaagatgaacagcctcaagccagatctcatgcagctccgcaagatgaga
gaccagtatttgatatggctgacgcagaaggggacaagacagaagaagatcaacgagtgg
ctgggcataaagaacgatgctgatgactcctactcacttgaggacgacgagggctcgccc
caccacgatgagtgcacctggtacgttggtgacatcaaacgatctcaggccgaagacatg
cttcgtggtaaatgtgacggaaccttcctgattcgtgagagccaatcacagaagggatcc
tacgcctgttctgtagttgtggacggttacaccaaacattgtgtggtctacaagacggcc
acgggttacggattcgctgagccctacaacctctattcctccctcaaagacctggtgctc
cactacaaaaatgtctctttggtccaacacaacgaccacctgaatgtaaatttagcctac
cctgtcctggcctgctctcagaaccagaaccaacacccaagatga

KEGG   Cynoglossus semilaevis (tongue sole): 103396148
Entry
103396148         CDS       T04866                                 

Definition
(RefSeq) LOW QUALITY PROTEIN: phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform-like
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103396148
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103396148
   04370 VEGF signaling pathway
    103396148
   04068 FoxO signaling pathway
    103396148
   04070 Phosphatidylinositol signaling system
    103396148
   04150 mTOR signaling pathway
    103396148
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103396148
  09143 Cell growth and death
   04210 Apoptosis
    103396148
   04218 Cellular senescence
    103396148
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103396148
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103396148
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103396148
   04625 C-type lectin receptor signaling pathway
    103396148
  09152 Endocrine system
   04910 Insulin signaling pathway
    103396148
   04914 Progesterone-mediated oocyte maturation
    103396148
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103396148
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103396148
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103396148
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103396148
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103396148
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_C2 PI3K_p85B DUF2321 Ribosomal_S15 C2 DUF5314
Other DBs
NCBI-GeneID: 103396148
NCBI-ProteinID: XP_008332354
LinkDB
Position
20
AA seq 1074 aa
MPPRPSSGELWGMHLMPPSILVDCLLPNGMILTLECLREATLITVKHELFKEARKYPLHN
LLQEESSYIFVSVTQEAEREEFYDETRRLCDLRLFQAFLKVIEPVGNREEKILNREIGFA
IGMPICEFDVVKDSEVQDFRRNILNVCKEAVDLRDSNGSHSRALYVYPPNVESSVELPKH
IYNKLDKGQIIVVIWVIISPSNDKQKYTLKINHDYVPEQVIAEAIRKKTRSMLLSQEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPLSQYKYVRSCIMLGRMPNLMLMSKESLYSQLPMD
NFTMPSYARRISTATPYMNGETATKPLWTINGTLRIKILCATYVNVNIRDIDKIYVRTGI
YHGGEQLCDNVNTQRVPCSNPRWNEWLNYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNINLFDYTHTLVAGKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SCPVKFPDMTTIEGHANWNISRELGFNYCHTGLSNRLARDNPLTDGDNDQLRQVCNRDPL
SEITEQEKDFLWRRRQDCLNMPEILPKILLAVKWNSRDEVAQMYCLLKDWPAIRPEQAME
LLDCNFPDPMIREFAVKCLEKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLESYCRACGMYLKHLSRQVEAMEKLINLTELLK
QEKKDEAQKVQMKFLVEQMRRPDYMDALQSFTSPLNPAHQLGNLRYVSTLLSHCLPRGMA
LKYFLELWLNWENPDMMSELLFQNNEIIFKNGDDLRQDMLTLQIIRIMENIWQNQGLDLR
MLPYGCLSIGDCVGLIEVVRNSHTIMQIQCKGGLKGALQFNSHTLHQWLKDKNKGEMYDQ
AIDLFTRSCAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRXXX
XXXXXXXXVISKGTQECTKTREFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQ
SFDDIAYIRKTLALDKTEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHAMN
NT seq 3225 nt   +upstreamnt  +downstreamnt
atgcctcccaggccctcctcgggagaactatgggggatgcacttgatgccccccagcatc
ctagtggactgcctcctgccaaatggcatgattctcacattggagtgcctccgggaagct
acgctgatcactgtcaagcatgagcttttcaaagaggccaggaaataccctttgcacaat
ctgctgcaagaggagagctcctacatctttgtcagtgtcactcaagaggcagagcgggaa
gagttctatgatgagacccggagactgtgtgatcttaggctctttcaagcgttcctcaaa
gttattgagccagtgggcaacagagaagagaaaatcctcaaccgtgaaattggttttgcc
atcggaatgcccatttgtgagtttgacgtggtgaaagattccgaagtgcaggacttcaga
aggaacattttaaacgtttgcaaagaagctgttgacctcagagacagtaacgggtcacac
agtcgagctttgtacgtctaccctcctaatgttgagtcttcggttgaacttcccaaacac
atctacaacaaactcgataaaggtcagatcattgttgtcatatgggttattatatcaccc
agcaatgacaaacagaaatacaccctgaagatcaaccacgactacgtgccggagcaggtg
atagcggaagccatccgtaagaagacgcggagtatgctgctctcccaggagcagctgaag
atgtgtgtgcaggagtatcaggggaaatacatcctcaaagtttgtggctgtgacgagtac
ttactggagaaataccctctgagtcagtacaagtacgtgcgtagttgcataatgctggga
cggatgcccaacctgatgctgatgtcaaaggaaagcctgtactctcagctgccgatggac
aacttcaccatgccgtcatatgcacgacgaatatccacggcaacgccgtacatgaatgga
gaaacggccaccaaaccgctgtggaccataaacggaacgctgaggatcaagattctatgt
gccacatacgtaaatgtcaacatcagagacattgacaagatctacgtcaggacaggtata
taccacggtggagagcagttgtgtgataacgtcaacacccagagagttccctgttcgaat
ccccggtggaacgagtggctcaactacgacatgtacattccagacatcccccgcgctgca
cgactctgcctctccatctgctccgtgaagggcaggaagggagcaaaagaggagcattgt
ccactggcctggggcaacatcaacctgtttgactatacacacactcttgtggccggaaag
atggctctgaacctgtggcccgtccctcacggcctggaggatctcctcaaccccattgga
gtcacgggctccaaccccaacaaggaaaccccatgtctggagctggagttcgaccatttc
agttgtcctgtcaagtttccggacatgaccaccattgaaggtcacgccaactggaacata
tcaagagaacttggcttcaattactgccacacgggtttgagtaacaggctggcacgtgac
aacccgctgactgacggcgacaacgaccagctacggcaggtgtgcaacagagacccgctg
tctgaaatcactgagcaggaaaaagactttctttggaggcgcagacaagactgtctgaac
atgccagagatactcccaaagatcctcctcgctgtgaaatggaactccagagatgaggtt
gcacagatgtattgccttctgaaggactggccagctatcaggcctgaacaagccatggag
ttgctggactgtaacttccccgatcccatgatcagagagtttgccgtgaagtgccttgag
aaatatcttacggatgacaaactttctcagtacctcattcagctagttcaggttctgaag
tatgagcagtacctcgataaccctcttgcgcgcttcctgctaaaaaaggcattaaccaat
cagaggataggacatttcttcttctggcatcttaagtcagagatgcacaacaagacagtg
agccagcggttcggcctgttgctggagtcctactgcagggcctgtggcatgtatctgaaa
cacctgagcagacaggtggaggccatggagaaactcatcaatctcactgaactgctcaaa
caggagaaaaaagatgaggcgcagaaggttcaaatgaagtttctggtggagcagatgaga
aggcccgactacatggatgcactccaaagcttcacctccccgctgaatcctgctcatcag
ctgggaaacctgcggtacgtcagcactctcttatctcactgcctccctcgaggaatggca
cttaaatatttcttagagctatggcttaactgggaaaatccagacatgatgtcggagctg
ctcttccagaacaatgaaatcatcttcaagaatggagatgatcttaggcaggacatgctg
acgctgcagatcattaggataatggagaacatctggcagaaccaaggccttgatctcaga
atgctgccctacggctgcctctcaattggcgactgcgtgggcttgatcgaggtggtgagg
aactctcacaccatcatgcagattcagtgtaaagggggcctgaagggggcgctgcagttc
aacagtcacacactgcatcagtggcttaaagacaagaacaagggagaaatgtatgatcag
gccatagatctgttcacacgttcatgtgcaggctactgtgtagccacatttatcctgggg
ataggggacagacacaacagcaacataatggtcaaagatgatggacagctgttccacata
gactttggtcattttctcgaccacaaaaagaagaagtttggctacaagaggnnnnnnnnn
nnnnnnnnnnnnnnnnnnnnnntcgtcatcagtaaaggaacccaagagtgtacaaaaaca
agggagtttgagagattccaggaaatgtgttacaaagcttacctggccatccggcagcat
gccaacctcttcatcaacctcttctccatgatgctgggttccgggatgcccgagctgcag
tcgtttgacgacattgcttacatcaggaagaccctggccctggacaagacggagcaggag
gccctggactacttcatgaagcagatgaacgatgctcaccatggcggctggaccacaaag
atggactggatttttcacacaatacgacagcacgccatgaactaa

KEGG   Cynoglossus semilaevis (tongue sole): 103396566
Entry
103396566         CDS       T04866                                 

Gene name
pik3ca
Definition
(RefSeq) phosphatidylinositol 4,5-bisphosphate 3-kinase catalytic subunit alpha isoform
  KO
K00922  phosphatidylinositol-4,5-bisphosphate 3-kinase catalytic subunit alpha/beta/delta [EC:2.7.1.153]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00562  Inositol phosphate metabolism
csem01100  Metabolic pathways
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05132  Salmonella infection
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00562 Inositol phosphate metabolism
    103396566 (pik3ca)
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103396566 (pik3ca)
   04370 VEGF signaling pathway
    103396566 (pik3ca)
   04068 FoxO signaling pathway
    103396566 (pik3ca)
   04070 Phosphatidylinositol signaling system
    103396566 (pik3ca)
   04150 mTOR signaling pathway
    103396566 (pik3ca)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103396566 (pik3ca)
  09143 Cell growth and death
   04210 Apoptosis
    103396566 (pik3ca)
   04218 Cellular senescence
    103396566 (pik3ca)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103396566 (pik3ca)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103396566 (pik3ca)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103396566 (pik3ca)
   04625 C-type lectin receptor signaling pathway
    103396566 (pik3ca)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103396566 (pik3ca)
   04914 Progesterone-mediated oocyte maturation
    103396566 (pik3ca)
 09160 Human Diseases
  09171 Infectious disease: bacterial
   05132 Salmonella infection
    103396566 (pik3ca)
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103396566 (pik3ca)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103396566 (pik3ca)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.153  phosphatidylinositol-4,5-bisphosphate 3-kinase
     103396566 (pik3ca)
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103396566 (pik3ca)
SSDB
Motif
Pfam: PI3Ka PI3_PI4_kinase PI3K_rbd PI3K_p85B PI3K_C2 C2 DUF2321 Ribosomal_S15
Other DBs
NCBI-GeneID: 103396566
NCBI-ProteinID: XP_008332924
UniProt: A0A3P8X0H3
LinkDB
Position
2
AA seq 1068 aa
MPPRPSSGELWGIHLMPPRILVDCLLPNGMILTLECLREATLITIKHELFKEARKYPLHH
LLQEETSYIFVSVTQEAEREEFYDETRRLCDLRLFQPFLKVIEPVGNREEKILNREIGFA
IGMPVCEFDLVKDPEVQDFRRNILNVCKDSVELRDACGPHSRALYVYPPNVESTQELPKH
IYSKLDKGQIIVVIWVIVSPNNDKQKYTLKINHDCVPEQVIAEAIRKKTRSMLLSPEQLK
MCVQEYQGKYILKVCGCDEYLLEKYPISQYKYIRSCIMLSRMPNLMLMAKDSLYTQLPTD
VFLMPSYSRRISTATSYMNGEAAAKSLWTINGTLRIRILCATYVNVNIRDIDKIYVRTGI
YHGGEQMCDTVNTQRVPCSNPRWNEWLTYDMYIPDIPRAARLCLSICSVKGRKGAKEEHC
PLAWGNVNLFDYTHTLVANKMALNLWPVPHGLEDLLNPIGVTGSNPNKETPCLELEFDHF
SSPVKYPDMNAVEDHANWTISRELGFNFNLSGQSNRVARDHALTEGDTEQLKQLSNRDPL
SEITEQEKDFLWRHRHYCMIIPEILPKILLAVKWNSRDEVAQMYCLLKDWPSIRPEQAME
LLDCNYPDPMVRQFAVRCLDKYLTDDKLSQYLIQLVQVLKYEQYLDNPLARFLLKKALTN
QRIGHFFFWHLKSEMHNKTVSQRFGLLLEAYCRACGMYLKHLSRQVEAMEKLINLTDILK
QEKKDETQKVQMRFLVDQMKRPDYMDALQNFTSPLNPAHQLGNLRLDECRIMSSAKRPLW
LNWENPDIMSELLFQNNEIIFKNGDDLRQDMLTLQIIKIMENIWQNQGLDLRMLPYGCLS
LGDCVGLIEVVRSSHTIMQIQCKGGLKGALQFNSNTLHQWLKDKNKGEMYDMAVDLFTRS
CAGYCVATFILGIGDRHNSNIMVKDDGQLFHIDFGHFLDHKKKKFGYKRERVPFVLTQDF
LIVISKGSQECAKTKEFERFQEMCYKAYLAIRQHANLFINLFSMMLGSGMPELQSFDDIA
YIRKTLALEKSEQEALDYFMKQMNDAHHGGWTTKMDWIFHTIRQHALN
NT seq 3207 nt   +upstreamnt  +downstreamnt
atgcctcccaggccgtcctcaggggagttatggggcatccacttgatgccacctaggatc
ctggtggattgtttgctgcccaatggcatgattctgaccctggagtgtctccgtgaggca
acgctcattacaatcaaacatgagctcttcaaggaagcaaggaaatatcctctccatcac
ctcctacaagaggagacatcctacatttttgtcagtgttacacaggaagcagagcgggag
gagttctatgatgagacacggaggttgtgtgatctccgacttttccagcccttcctcaag
gtcattgaacctgttggaaacagagaagaaaagatactcaacagagagattggtttcgcc
attgggatgcctgtgtgtgagtttgaccttgttaaggaccctgaagtgcaggacttcagg
agaaacattctaaatgtgtgtaaagactccgtggagttgagagatgcatgtgggccacac
agcagagcactgtatgtttacccacccaacgtggaatccacgcaggaacttcccaaacac
atctatagcaaactggacaaaggtcagatcattgtggtgatatgggtgattgtttctccg
aacaatgacaaacagaagtacacactaaagattaatcatgactgtgtgcctgagcaggtg
attgcggaggctattcgtaagaagacgcgcagcatgctgttgtccccagagcagctgaag
atgtgtgttcaggaataccagggtaaatacatcctaaaagtctgtggctgtgatgagtac
ctgctggaaaagtaccccatcagtcagtacaagtatattcgtagttgcatcatgctgagc
aggatgcctaacctgatgctgatggccaaggacagcctttacactcagttgcccacggat
gtatttttaatgccgtcatactcccggcgcatctctacagctacgtcctacatgaatgga
gaggcagctgccaagtcattgtggaccatcaatggaactctgagaataagaatcctctgt
gccacttacgttaacgtcaacatacgggatatagacaagatctatgtgaggaccggcatt
taccatggaggtgaacagatgtgtgatactgtcaacacacagagagtgccctgctctaat
cctaggtggaatgagtggctcacatatgacatgtacatccctgacatcccacgtgctgcc
agactctgcctgtctatttgctcagtcaagggcagaaagggtgccaaagaggaacattgt
ccattagcctggggtaatgtcaacttgtttgactacactcacactttagtggccaacaag
atggcactgaatctttggcctgtccctcatggccttgaagaccttcttaatcctataggg
gtcacggggtccaaccccaacaaggaaacgccatgtttggagctggagtttgaccacttc
agcagtccagtcaaatacccagacatgaatgcagtagaggatcatgctaactggaccatc
tccagagaactgggattcaacttcaacttgtctggtcagagcaatcgtgttgcccgagat
catgcactaacagagggcgacacggagcagctgaagcagctgagcaacagagaccctctg
tcagaaatcactgagcaggagaaagatttcctctggagacacagacactactgcatgatc
atccctgagatccttccaaagatcctcctcgctgtaaagtggaactccagagatgaggtc
gcacagatgtactgcttgttgaaggactggccgtccattcggcctgaacaggccatggag
ctgttagactgtaactacccagaccccatggtcagacaatttgctgtgcgctgtcttgac
aaatacctaactgatgacaaactgtctcagtacttgatccagctcgtacaggttttaaaa
tatgagcagtatcttgacaatcctctggctcgctttctactcaaaaaggccctgaccaat
caaaggataggacatttcttcttctggcatctcaagtcagaaatgcacaataaaacagtg
agccagcgatttggacttctgttagaggcttactgcagggcatgtggcatgtacctgaaa
cacctgagcagacaggtggaggctatggaaaagctcataaacctgactgatatcctgaaa
caggagaagaaagatgagacgcaaaaggtccagatgcggtttctcgtggaccagatgaag
agacctgactacatggatgccctgcagaacttcacctctccactcaaccctgcacaccaa
cttggaaacctgaggttagacgaatgcaggatcatgtcgtcagcaaagagaccattgtgg
ctgaactgggaaaatcctgacatcatgtctgaacttcttttccagaacaatgaaatcata
tttaaaaatggagatgacttgcggcaggatatgctgacgttgcagattatcaaaatcatg
gagaatatttggcagaatcagggactggacctgcggatgcttccctatggctgcctgtca
ttaggagactgcgtgggcctcattgaggtggttcgcagctcccacacgatcatgcagatt
cagtgtaaaggaggtttgaaaggagctctgcagttcaactcgaacactctgcatcagtgg
ctcaaggacaagaacaagggcgagatgtatgacatggctgtggatttatttacaaggtcc
tgtgctggctactgtgtagctacatttatcctggggataggagacagacacaacagtaac
ataatggtcaaagatgacggtcagttgtttcacatagattttggacattttcttgatcac
aagaagaagaaatttggctacaagagagaacgagtgccctttgttctgacacaagacttc
cttattgtcatcagcaaaggatcccaggagtgcgcaaagaccaaagagtttgagaggttc
caggagatgtgttacaaagcctacctggccatcaggcagcatgcaaacctcttcatcaac
ctcttctccatgatgctgggctctggcatgcctgagctgcagtcatttgacgacattgcc
tacatccggaagactctggccttggagaaaagtgagcaggaggccttggactactttatg
aaacagatgaacgatgctcaccatggaggatggaccacaaagatggactggattttccac
acaattagacagcatgcactaaactga

KEGG   Cynoglossus semilaevis (tongue sole): 103398008
Entry
103398008         CDS       T04866                                 

Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit alpha-like
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103398008
   04370 VEGF signaling pathway
    103398008
   04068 FoxO signaling pathway
    103398008
   04070 Phosphatidylinositol signaling system
    103398008
   04150 mTOR signaling pathway
    103398008
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103398008
  09143 Cell growth and death
   04210 Apoptosis
    103398008
   04218 Cellular senescence
    103398008
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103398008
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103398008
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103398008
   04625 C-type lectin receptor signaling pathway
    103398008
  09152 Endocrine system
   04910 Insulin signaling pathway
    103398008
   04914 Progesterone-mediated oocyte maturation
    103398008
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103398008
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103398008
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103398008
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 RhoGAP SH3_1 AAA_13 SH3_9 SH3_2 RNA_binding Laminin_I Mod_r PI_PP_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 103398008
NCBI-ProteinID: XP_008334705
LinkDB
Position
Z
AA seq 717 aa
MSSEGFQYRALYDYKKEREEDIDLHVGDMLLVSKGALLALGCGNGAEERPSEIGWLPGFN
ETTQEKGDFPGTYVEFVGRKRMSPPTPKPRPPRPPSAASARTDSESDGFVLADLPDQFGP
PDTAPPLLNRLMEAIETKGLDCPTIYRNVSGGGPDTRQLAEADLDQLEVSSLCDGVVRFL
LDLPGPVLPSSLQADMIHQVQEVRDLEECAQVLRGVASSPVCQAQYGLTLLSVVRHFARI
CLHSSRNQLTPRNLAESFSPLVFRQMAGSECGLDPLVQVLEILITSELNMNQAAPALPPK
PVKSSTPAAASSFNNSIALQDAEWYWGDISREEVNDKLRDTADGTFLVRDASTKMHGDYT
LTLRKGGNNKLIKIFHREGKYGFSDPLTFSSVVELINHYRHESLAQYNHKLDVKLLYPVS
KHQQDQVVKEDSIEAVGKKLHEYHLQYQEKNREYDRLYEEYTRTSQEIQMKRTAIEAFNE
TIKIFEEQCQTQERFSKEYIEKFRREGNDKEIQRIMENYDKLKSRINEIVDSKRHLEVDL
KKQAADYREIDKKMNSIKPDLIQLRKTRDQYLMWLTQKGVRQRKLNEWLGLKNDTTEDEY
SMVDDEEDLPHHDERLWRLGNINRNQAESLLRGKRDGTFLVRDSSKSGCYACSVVVDGEV
KHCVINKTSTGYGFAEPYNLYGSLKELVLHYQHTSLVQHNDSLNVTLAFPVYSQQRR
NT seq 2154 nt   +upstreamnt  +downstreamnt
atgagttccgagggctttcagtaccgagcgctgtacgactacaagaaggagagggaggag
gacatcgacctgcacgtgggggacatgttgctggtcagtaagggagcgctgctagctctg
ggctgcggcaacggagctgaggaacgaccgtcggagatcggatggctgcccggcttcaac
gagaccacccaggaaaaaggcgacttcccggggacgtatgtggagtttgtcggccgaaag
agaatgtctccacccacgcccaagccacgcccacccagaccaccgtcagcagcgtcggcg
aggaccgactcggaatctgatgggtttgtgcttgcggacctcccagatcagttcggaccc
ccggacaccgcccctcccctccttaacagattgatggaggccatagagaccaaaggtctg
gactgtcccaccatttatcgcaatgtgagcggaggaggcccggacacccggcagttggct
gaagctgacctggaccagttggaggtgtcgtccctgtgtgacggcgtggtccgcttcctg
ctggacctccctggtcccgtcctcccgtcttcattacaggccgacatgattcaccaagta
caagaggtcagggatttggaggagtgtgctcaggtcctgcggggagtagccagctctccg
gtctgccaggcccagtacggcctgactctgctcagcgtggtccgacacttcgcccggatc
tgtttacacagctccaggaaccagctgaccccccggaacctggccgagagctttagtccg
ttagtcttcagacagatggcagggtctgaatgtggtttggatcctctggttcaggttttg
gagattctgataaccagtgaactcaacatgaatcaggctgcaccagcgttgcctcccaaa
ccagtgaagtcatcaactccggcagctgccagcagcttcaacaacagcatcgctctgcag
gacgccgagtggtactggggcgacatctccagagaggaggtgaatgacaagctgagagac
acggccgatggaacgttcctggtgcgagacgcgtcgacgaagatgcacggagactacacc
ctgactctgaggaaaggaggcaacaacaaactgatcaagatttttcatcgcgaagggaag
tacggcttctctgaccccttgaccttcagctcggtggtggagctcatcaaccactaccgc
cacgagtctctggcccagtacaaccacaaactggacgttaagctgctgtaccccgtctcc
aaacaccagcaggaccaggtggtgaaggaggacagcatcgaagctgtgggcaagaagctc
cacgagtaccatctgcagtaccaggagaagaacagagagtacgacaggctgtacgaagag
tacaccaggacctcgcaggagatccagatgaagcgcacggccatcgaggccttcaacgag
accatcaagatcttcgaggagcagtgccagacgcaggagcgcttcagcaaagagtacatc
gagaagttccgccgagagggcaacgacaaggagatccagaggatcatggaaaactacgac
aagctgaagtcccggatcaacgagattgtagacagcaaacgccacctagaggtggacctg
aagaaacaggcggccgactacagggagatcgacaagaagatgaacagcatcaaacccgac
ctgatccagctccgcaagaccagggaccagtacctcatgtggctgactcagaaaggcgtt
cgtcagaggaaactgaacgaatggctcggtttgaaaaacgacaccacagaggatgagtac
agtatggtggatgacgaggaggacctccctcaccacgacgaacgtctttggcgcctggga
aacattaaccgcaaccaggctgagtctctgctgcgagggaagcgggacggtaccttcctg
gtccgagacagcagcaaatctggctgctacgcctgctctgtggtggtggacggcgaggtc
aaacactgcgtcatcaacaagaccagcaccggctacggcttcgctgagccctacaacctg
tacggctccctgaaggagctggtgctgcactaccagcacacgtcgctggtccaacacaac
gactcgctcaacgtcacgctggcgttccccgtctacagccaacagaggcggtga

KEGG   Cynoglossus semilaevis (tongue sole): 103399010
Entry
103399010         CDS       T04866                                 

Gene name
pik3r3
Definition
(RefSeq) phosphatidylinositol 3-kinase regulatory subunit gamma isoform X1
  KO
K02649  phosphoinositide-3-kinase regulatory subunit alpha/beta/delta
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04070  Phosphatidylinositol signaling system
csem04140  Autophagy - animal
csem04150  mTOR signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
csem04370  VEGF signaling pathway
csem04510  Focal adhesion
csem04620  Toll-like receptor signaling pathway
csem04625  C-type lectin receptor signaling pathway
csem04810  Regulation of actin cytoskeleton
csem04910  Insulin signaling pathway
csem04914  Progesterone-mediated oocyte maturation
csem05168  Herpes simplex virus 1 infection
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103399010 (pik3r3)
   04370 VEGF signaling pathway
    103399010 (pik3r3)
   04068 FoxO signaling pathway
    103399010 (pik3r3)
   04070 Phosphatidylinositol signaling system
    103399010 (pik3r3)
   04150 mTOR signaling pathway
    103399010 (pik3r3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04140 Autophagy - animal
    103399010 (pik3r3)
  09143 Cell growth and death
   04210 Apoptosis
    103399010 (pik3r3)
   04218 Cellular senescence
    103399010 (pik3r3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103399010 (pik3r3)
  09142 Cell motility
   04810 Regulation of actin cytoskeleton
    103399010 (pik3r3)
 09150 Organismal Systems
  09151 Immune system
   04620 Toll-like receptor signaling pathway
    103399010 (pik3r3)
   04625 C-type lectin receptor signaling pathway
    103399010 (pik3r3)
  09152 Endocrine system
   04910 Insulin signaling pathway
    103399010 (pik3r3)
   04914 Progesterone-mediated oocyte maturation
    103399010 (pik3r3)
 09160 Human Diseases
  09172 Infectious disease: viral
   05168 Herpes simplex virus 1 infection
    103399010 (pik3r3)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103399010 (pik3r3)
Membrane trafficking [BR:csem04131]
 Endocytosis
  Rab GTPases and associated proteins
   Rab associated proteins
    103399010 (pik3r3)
SSDB
Motif
Pfam: PI3K_P85_iSH2 SH2 CC2-LZ Mod_r DUF4201 Laminin_I Bap31_Bap29_C
Other DBs
NCBI-GeneID: 103399010
NCBI-ProteinID: XP_008335984
UniProt: A0A3P8UIF6
LinkDB
Position
2
AA seq 477 aa
MYNTVWTTEKAAEEGDWRDVMMPYSTELIFYLEMDQQPPALPPKPAKSQQPSSVGVVGGG
SSSSGGAKDGGAAGLLQEAEWYWGDISREEVNDKLRDMPDGTFLVRDASTKMQGDYTLTL
RKGGNNKLIKIYHRDGKYGFSDPLTFCSVVELISHYRHESLAQYNTKLDVKLMYPISRFQ
QDQLVKEDNIDAVGKKLQEYHGQYQDKSKEYDKLYEEYTKTSQEIQMKRTAIEAFNETIK
IFEEQCHTQECYSKDYIDRFCREGNDKEIERIMINYEKLKSRLGEIHDSKVRLEQDVTTQ
AMDNRETDKKMNSLKPDLIQLRKIRDQYLVWLNHKGVRQKRINDWLGIKNESTDEGCFVN
EEDENLPHHDEKSWFVGDLNRTQAEELLLGKPDGSFLIRESSKKGCYACSVVVEGEVKHC
VIYSTPRGFGFAEPYNLYSSLKDLVLHYHHTSLVQHNDSLNIRLAHPVYAQMPSGHR
NT seq 1434 nt   +upstreamnt  +downstreamnt
atgtataacacagtgtggacgacggagaaagccgccgaggaaggagactggagggacgtg
atgatgccctattccacggagctgatattttacctggaaatggaccaacaaccaccagct
ctacctccaaagccggccaagtcccagcagccctcatcagtgggtgtcgtgggagggggc
agtagcagcagcggtggagccaaggatggaggagcagcaggattgttgcaggaggctgag
tggtactggggagacatatccagggaggaggtgaacgacaaactcagagacatgcccgac
ggcaccttcctggttagagacgcttcaaccaagatgcagggcgactacacactgactctg
agaaaaggcggcaacaacaaactgataaagatctaccaccgggacgggaaatacggcttc
tctgaccccctgaccttctgctcagtggtggagctcatcagccactacagacacgagtct
ctggcccagtacaacaccaagcttgacgttaagctcatgtatcccatctctcgcttccag
caggatcagttggtgaaggaggataacattgacgctgtggggaaaaagcttcaggaatac
cacggtcagtaccaggacaagagcaaagagtacgacaaactgtacgaggagtacaccaag
acgtcacaggagatccagatgaagagaactgccatcgaggccttcaacgagaccatcaag
atcttcgaggagcagtgccacacgcaggagtgctacagcaaggactacatcgaccgcttc
tgtcgagaaggcaacgacaaggagatcgagcggatcatgatcaactacgagaaactcaag
tctcggctgggcgagatccacgacagcaaggtgcggctggagcaggacgtgacgacacag
gcgatggacaaccgtgagacggacaagaagatgaacagcctgaagcctgacctcatacag
ctccgcaagatcagggaccaatatctagtctggctgaatcacaaaggagttcgccagaaa
cggattaacgactggctgggaatcaagaacgagagcactgacgaaggctgctttgtgaac
gaggaggatgagaacctgccccaccatgatgagaagagctggttcgtgggcgacctgaac
aggacgcaggcggaggagctgctgctggggaaaccagacggatccttcctgatcagagag
agcagcaaaaagggctgctacgcctgctctgttgttgtggagggggaggtgaagcactgc
gtcatctacagcacaccgcgaggcttcggctttgctgagccctacaacctgtacagcagc
ctgaaggacctggtgctccactatcaccacacttccctggtgcagcacaacgactcgctc
aacatccgcctcgctcaccccgtctacgcacagatgccctcgggacacagatga

DBGET integrated database retrieval system