KEGG   Cynoglossus semilaevis (tongue sole): 103378759Help
Entry
103378759         CDS       T04866                                 

Gene name
sord
Definition
(RefSeq) sorbitol dehydrogenase
  KO
K00008  L-iditol 2-dehydrogenase [EC:1.1.1.14]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00040  Pentose and glucuronate interconversions
csem00051  Fructose and mannose metabolism
csem01100  Metabolic pathways
Module
csem_M00014  Glucuronate pathway (uronate pathway)
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00040 Pentose and glucuronate interconversions
    103378759 (sord)
   00051 Fructose and mannose metabolism
    103378759 (sord)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.14  L-iditol 2-dehydrogenase
     103378759 (sord)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: ADH_zinc_N ADH_N Glu_dehyd_C AlaDh_PNT_C ADH_zinc_N_2 Pyr_redox_2 2-Hacid_dh_C
Motif
Other DBs
NCBI-GeneID: 103378759
NCBI-ProteinID: XP_008308301
UniProt: A0A3P8US43
LinkDB All DBs
Position
5
AA seq 354 aa AA seqDB search
MAQENLSVVLRSQGDLRLENLPIPEPGPDDVLLQMHSVGICGSDVHYWQHGRIGDFVVRK
PMVLGHEAAGVVVKTGSAVKHLKIGDRVAIEPGVPRDMDEFFKNGRYNLSPSIFFCATPP
DNGNLCRYYKHNANFCYKLPDNVTFEEGALIEPLSVGIHACRRGGVTLGSTVFICGSGPI
GLVCLLVAKAMGASKVIISDIVPERLSMAKELGADFQLQVKRENGPQQLAKSVEDLLGAQ
PHVTIECTGVESSVQTAIYATRSGGVVVLVGLGSEMATIPLINAAVREVDIRGVFRYCNT
WPMAINMLASGKVNVKPLVTHRFPLEQAVQAFETTRQGVGIKVMLKCNQNDQNP
NT seq 1065 nt NT seq  +upstreamnt  +downstreamnt
atggcgcaggaaaacctctctgtggtgcttcgttctcaaggcgacctgcgacttgaaaat
ctacccattcccgaaccaggacctgatgatgttttgctgcagatgcactcagtgggaata
tgtggatcagacgttcactactggcagcacggtagaatcggagacttcgtggtccgaaaa
ccaatggtcttgggtcatgaagctgcaggggtagtggtgaaaactggatctgctgtgaaa
caccttaaaatcggtgacagagtggccattgagcccggtgttccccgagacatggacgag
ttcttcaaaaatggacgatataacttatctccgtccatcttcttctgtgccacacccccc
gacaatgggaacctgtgcagatactacaagcacaatgccaacttctgctacaagttgcct
gataatgtgacatttgaagagggagccctgattgaaccactgtctgtagggatccacgcc
tgtcgcagaggtggcgtcaccctcggcagcactgtcttcatctgtggttcaggacctatt
gggttggtctgtttgcttgtggccaaagcaatgggagcctcaaaagtcatcatatctgat
attgtcccagagcgtctgtcgatggctaaagagctcggtgcagatttccagctgcaggtt
aagagagagaacggaccacagcaactggccaagtctgtagaagacctgctgggagcgcag
cctcatgtcactattgaatgcactggtgtggagagcagtgtccaaactgccatatatgca
acacgctcaggaggtgtggtagttctggtgggtctgggctcagagatggcaaccattcct
ctgataaatgctgctgtgagggaagtggacatcagaggagtttttcgttattgcaacacc
tggccaatggccatcaacatgttggcgtcaggtaaggtcaacgtgaagcccctcgtgacc
caccgtttccctctggagcaggcagtccaggcctttgagacgacccgtcagggggttggg
attaaggtcatgttaaagtgtaaccagaatgatcagaacccttga

DBGET integrated database retrieval system