KEGG   Cynoglossus semilaevis (tongue sole): 103379080
Entry
103379080         CDS       T04866                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103379080
   04340 Hedgehog signaling pathway
    103379080
   04371 Apelin signaling pathway
    103379080
   04068 FoxO signaling pathway
    103379080
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103379080
   04115 p53 signaling pathway
    103379080
   04218 Cellular senescence
    103379080
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103379080
   04530 Tight junction
    103379080
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103379080
NCBI-ProteinID: XP_008308727
UniProt: A0A3P8VWR7
LinkDB
Position
5
AA seq 293 aa
MEDQLLCCEVDSIKRAHQDVNLLNDRVLNTMLKAEESYLPSPNYLKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFTLAMNYLDRFLSVEATKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPDELLQMELLVLNKLKWDLAAITPHDFIEHFLSKLKIHQSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDSSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQYSGSATETKRLEEDVDLSCTPTDVRDINI
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgttgcgaggtggactccatcaagagagcccaccaggacgtc
aacctgctcaacgaccgagtcctcaacaccatgctaaaggcggaggagagctacctgccg
tcccccaactacttaaagtgtgtgcagaaagaaatagtgcccaaaatgaggaagatagtt
gctacctggatgttagaggtctgcgaggaacagaaatgtgaagaggaggtttttactctg
gctatgaactatttggacagatttttatcagtggaagcaaccaagaaaacgagactgcag
ctgctgggagccacatgcatgtttctggcatccaagatgaaggagacggttcccctaacg
gcagagaaactctgtatctacaccgacaactctgtgcttcctgacgaactcctgcaaatg
gagctgctggtcctcaacaagttgaagtgggacctggccgctatcacaccccacgacttt
atcgagcacttcctgtccaagctgaagatccaccagtccaccaagcagatcctcaggaaa
cacgcccagacgtttgtggcactctgcgccacagatgttaacttcatcgctagtccacca
tccatggtagcagcaggcagtgtagtcgcagctgtgcaaggcctgtacctgaaaagtcaa
gactcttccctttcctctcagaacctcaccaacttcctgtcacaggtcatccgcagtgat
ccggactgcctgagatcatgtcaggaacagatcgagtctctgctggagtccagcctacga
caggcccagcagtacagcggcagtgccacagaaaccaaacgcctggaggaggatgtggac
ctgtcctgcacacccacagacgtcagagacattaacatttga

DBGET integrated database retrieval system