KEGG   Cynoglossus semilaevis (tongue sole): 103379080
Entry
103379080         CDS       T04866                                 

Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103379080
   04340 Hedgehog signaling pathway
    103379080
   04371 Apelin signaling pathway
    103379080
   04068 FoxO signaling pathway
    103379080
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103379080
   04115 p53 signaling pathway
    103379080
   04218 Cellular senescence
    103379080
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103379080
   04530 Tight junction
    103379080
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103379080
NCBI-ProteinID: XP_008308727
UniProt: A0A3P8VWR7
LinkDB
Position
5
AA seq 293 aa
MEDQLLCCEVDSIKRAHQDVNLLNDRVLNTMLKAEESYLPSPNYLKCVQKEIVPKMRKIV
ATWMLEVCEEQKCEEEVFTLAMNYLDRFLSVEATKKTRLQLLGATCMFLASKMKETVPLT
AEKLCIYTDNSVLPDELLQMELLVLNKLKWDLAAITPHDFIEHFLSKLKIHQSTKQILRK
HAQTFVALCATDVNFIASPPSMVAAGSVVAAVQGLYLKSQDSSLSSQNLTNFLSQVIRSD
PDCLRSCQEQIESLLESSLRQAQQYSGSATETKRLEEDVDLSCTPTDVRDINI
NT seq 882 nt   +upstreamnt  +downstreamnt
atggaggaccagctgctgtgttgcgaggtggactccatcaagagagcccaccaggacgtc
aacctgctcaacgaccgagtcctcaacaccatgctaaaggcggaggagagctacctgccg
tcccccaactacttaaagtgtgtgcagaaagaaatagtgcccaaaatgaggaagatagtt
gctacctggatgttagaggtctgcgaggaacagaaatgtgaagaggaggtttttactctg
gctatgaactatttggacagatttttatcagtggaagcaaccaagaaaacgagactgcag
ctgctgggagccacatgcatgtttctggcatccaagatgaaggagacggttcccctaacg
gcagagaaactctgtatctacaccgacaactctgtgcttcctgacgaactcctgcaaatg
gagctgctggtcctcaacaagttgaagtgggacctggccgctatcacaccccacgacttt
atcgagcacttcctgtccaagctgaagatccaccagtccaccaagcagatcctcaggaaa
cacgcccagacgtttgtggcactctgcgccacagatgttaacttcatcgctagtccacca
tccatggtagcagcaggcagtgtagtcgcagctgtgcaaggcctgtacctgaaaagtcaa
gactcttccctttcctctcagaacctcaccaacttcctgtcacaggtcatccgcagtgat
ccggactgcctgagatcatgtcaggaacagatcgagtctctgctggagtccagcctacga
caggcccagcagtacagcggcagtgccacagaaaccaaacgcctggaggaggatgtggac
ctgtcctgcacacccacagacgtcagagacattaacatttga

KEGG   Cynoglossus semilaevis (tongue sole): 103379657
Entry
103379657         CDS       T04866                                 

Definition
(RefSeq) G1/S-specific cyclin-D2-like isoform X1
  KO
K10151  G1/S-specific cyclin-D2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103379657
   04340 Hedgehog signaling pathway
    103379657
   04068 FoxO signaling pathway
    103379657
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103379657
   04115 p53 signaling pathway
    103379657
   04218 Cellular senescence
    103379657
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103379657
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 103379657
NCBI-ProteinID: XP_008309492
UniProt: A0A3P8X3Q1
LinkDB
Position
6
AA seq 297 aa
MELLCLEMDTIIRASPDPNLLCDDRVLQSLLTIEERFLPQFSYFKGVQKDIQPFMRRMVA
TWMLEVCEEQKCEEEVFPLAMNYLDRFLAVVPTKKCNLQLLGAVCMFLASKLKETRPLTA
EKLCIYTDNSIRPQELLEWELVVLGKLKWNLAAVTPNDFIEHIVRRLPLPEDKLALIRKH
VQTFIALCATDFRFAMYPPSMIATGSVGAAICGLQLDSADQSQWGEGLTDLLAKITNTEV
DVLKECQEQIERVLVSSLREGRQQQQQQQQTQRGPSGKGLDELDQSSTPTDVRDVNL
NT seq 894 nt   +upstreamnt  +downstreamnt
atggagctgctctgcctcgaaatggacaccatcattcgagctagtcccgatcccaacctc
ctgtgcgatgacagagtcctgcaaagcttgttgaccatagaggagagatttctaccccag
ttctcctattttaaaggcgtccagaaagatattcagccctttatgcggaggatggtcgcc
acttggatgttggaggtctgtgaggagcagaagtgcgaggaagaagttttccctctggcc
atgaactacttagacagatttttagccgtggtacccaccaaaaagtgcaacctgcagctg
ctgggggcagtctgcatgttcctcgcgtccaaattgaaagagactcgtccattaactgca
gagaaactttgcatctacacagacaattccatcagaccacaggagctgctggaatgggaa
ctggtggtgttggggaagttgaagtggaacttggcagcggtgacaccaaatgacttcatt
gagcacattgtgagacggctgccactgcctgaggataagctggcacttattcgcaaacac
gtccagaccttcatcgccctctgtgccacagatttcagatttgccatgtaccccccctcc
atgattgccacaggaagtgtgggggcagcgatctgcggcctccagctggattcagcggac
cagtcacagtggggcgagggtctcacagacctgctcgccaaaatcacaaacacagaagtg
gatgttcttaaagagtgtcaggaacagatcgagcgcgtgctggtcagcagcctgcgtgag
ggccgacagcagcagcagcagcagcagcagacacagaggggtcccagtggaaaaggtctc
gacgagctggaccagtcctccaccccgacagacgtccgcgatgtcaacttgtga

KEGG   Cynoglossus semilaevis (tongue sole): 103379853
Entry
103379853         CDS       T04866                                 

Gene name
ccnd1
Definition
(RefSeq) G1/S-specific cyclin-D1
  KO
K04503  G1/S-specific cyclin-D1
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04371  Apelin signaling pathway
csem04510  Focal adhesion
csem04530  Tight junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103379853 (ccnd1)
   04340 Hedgehog signaling pathway
    103379853 (ccnd1)
   04371 Apelin signaling pathway
    103379853 (ccnd1)
   04068 FoxO signaling pathway
    103379853 (ccnd1)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103379853 (ccnd1)
   04115 p53 signaling pathway
    103379853 (ccnd1)
   04218 Cellular senescence
    103379853 (ccnd1)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103379853 (ccnd1)
   04530 Tight junction
    103379853 (ccnd1)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103379853
NCBI-ProteinID: XP_008309773
UniProt: A0A3P8UFS4
LinkDB
Position
6
AA seq 293 aa
MEPQLLCCEGDRPARAYRDSNLLTDRVLGALLRAEENYLPASNYFKCVQREIAPYMRRIA
ATWVLEVCEEQRCEEEVFPLAMNYMDRFLSVEPVKKNHLQLLGAACMFLASKLKETIPLT
AEKLCIYTDNSITTSQLLQMELLVLNKLKWDLASVTPLDFIDHFLSRLPVRRECRSILRK
HAQTFVALCATDTNFIASPPSMVAAGSMVAAVEGLQLKMLGNTSMSQKLTEQLAQTIRSD
PDCLRACQEQIESLLETSLGQARQQHTVTMETKNSGEGQDLSSTPTDVRDVNI
NT seq 882 nt   +upstreamnt  +downstreamnt
atggagccccagctgctgtgctgtgagggggacaggcctgccagggcctaccgggactcc
aacctgttgacggaccgggtcctgggagctctcctgcgggcagaggagaattacctcccc
gcttcgaactactttaaatgcgtccagagagaaatcgctccgtacatgaggaggatagcg
gccacctgggtgctggaggtgtgtgaggagcaaaggtgtgaagaggaggttttccctctg
gccatgaactacatggaccgcttcctgtctgtggagcccgtcaagaagaaccacctgcag
ctactgggagctgcctgtatgttcctggcatccaaactaaaggagaccatcccactgacc
gccgagaagctctgcatctacacagacaactccatcaccacgtctcagctgctgcaaatg
gagctgctggttttgaacaaactcaagtgggacctggcctctgtgacgccactggatttc
atcgaccacttcctgtcccggctgcccgtcagaagagagtgccggtccatactcaggaag
cacgctcagacctttgtggcgctctgtgccacagacaccaatttcatcgccagccccccg
tccatggtggcggccggcagcatggtggcagcagtggagggcttacagctgaagatgctg
gggaacacatccatgtcccagaaactgacagagcagcttgcacagaccatcaggagcgac
ccggactgtctcagagcgtgtcaggaacaaatagagtcgctgctagaaaccagcctcgga
caggcacggcagcaacacacggttactatggaaactaagaacagtggtgaggggcaggac
ctctcgtccacacccacagatgtccgtgacgtaaacatctga

KEGG   Cynoglossus semilaevis (tongue sole): 103382708
Entry
103382708         CDS       T04866                                 

Gene name
ccnd2
Definition
(RefSeq) G1/S-specific cyclin-D2
  KO
K10151  G1/S-specific cyclin-D2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103382708 (ccnd2)
   04340 Hedgehog signaling pathway
    103382708 (ccnd2)
   04068 FoxO signaling pathway
    103382708 (ccnd2)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103382708 (ccnd2)
   04115 p53 signaling pathway
    103382708 (ccnd2)
   04218 Cellular senescence
    103382708 (ccnd2)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103382708 (ccnd2)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103382708
NCBI-ProteinID: XP_008313811
UniProt: A0A3P8V9Q8
LinkDB
Position
8
AA seq 309 aa
MEKDRSGGRKKVTQVSELYCLESDITVKALPDPHILHDDRVLQSLLTIEDRFLPQCSYFQ
RVQKDIQPYMRRIVAGWMHEVCELERCCEDVFPLSINYLDRFLAVMPTRKSFLQLLAAVC
MFLASKLKDSRPLSAEKLCMYTDNSITLQDLLNWELVVLGKLKWNMASVIPNDFIEHIIR
RLPLPKDNVVTIRKHTLTFIALCATDDRLAMNPPSMIASGSMGAAVCGLKLEQVDPSLSQ
EGLTDLLAKITNTEVDCLRACQEQIERVLASSLQQGQQHRQENGISAGNKAMEQQDQSST
PTDVRDVNL
NT seq 930 nt   +upstreamnt  +downstreamnt
atggagaaagacagaagcggagggagaaagaaggtgacccaagtctcggagctgtattgc
ctggagtcggacataaccgtgaaagctctgcctgacccgcacatcctccatgatgacaga
gtgttgcaaagtttattaacaatcgaggataggtttttacctcagtgctcgtactttcag
cgggtccagaaggacattcaaccctatatgagacgaatagttgcaggctggatgcacgag
gtttgtgaattggagaggtgctgtgaggacgtcttccccttatcaattaattatttggac
aggtttttagcagtaatgcccactcggaaaagctttctgcagcttctggcggctgtgtgc
atgttcctggcctccaagctaaaagacagcaggccactgtcagcagaaaaactctgcatg
tacacagacaactctatcacactacaggatctgctgaactgggaactggtggtgctggga
aaattgaagtggaacatggcctcagtcattccaaatgatttcatagagcacatcatacgc
aggcttccccttcccaaagacaatgtggtgacgatccgcaaacacaccctgacattcatc
gccctctgtgccacagatgaccgcctcgccatgaaccctccttccatgatcgcctctggc
agtatgggagctgctgtatgtggcctaaagttggagcaggtcgaccccagtctcagtcaa
gaaggtctcacagatctgctggccaaaatcacaaacacagaggtggactgtttgagggcc
tgccaggagcaaatcgagcgtgttctggccagcagcctgcagcagggtcagcagcatcgt
caggagaacggcatcagtgctggaaacaaagccatggagcagcaggaccagtccagcacc
cccacagatgtacgtgatgtcaacttatga

KEGG   Cynoglossus semilaevis (tongue sole): 103385889
Entry
103385889         CDS       T04866                                 

Gene name
ccnd3
Definition
(RefSeq) G1/S-specific cyclin-D3
  KO
K10152  G1/S-specific cyclin-D3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103385889 (ccnd3)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103385889 (ccnd3)
   04115 p53 signaling pathway
    103385889 (ccnd3)
   04218 Cellular senescence
    103385889 (ccnd3)
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103385889 (ccnd3)
SSDB
Motif
Pfam: Cyclin_N Cyclin_C
Other DBs
NCBI-GeneID: 103385889
NCBI-ProteinID: XP_008318133
LinkDB
Position
11
AA seq 322 aa
MTQWTMADCEKEELKSELREKNNCISGHNVFHRAVTDPAVNGDLRALRYLRAQELQCSTT
PHGERVQSDIRPYMRRLLAMWMFQVCEEQKCEEEVFPLAMHYLDSYLRQFTIEKERLQLL
GTVCMFLASKMRETVSLTVNTLCIYADNSISATDILQWEMLVVSRLDWCLASVIPSDFLE
PILHALPFVQPMHFQNMRRHVHCYIALAATDDRFSVFMPSTLACACISLAVQGVKSADAN
TSPEIVTKFLADLLCIDLNSICLCCEQLRSLLEHSLPSCFRSGSKVKTRGSEISYTPGDS
QHVAATPKNLPSSVTNKSGRME
NT seq 969 nt   +upstreamnt  +downstreamnt
atgactcagtggaccatggcggattgcgagaaagaggaacttaaatccgaattaagggag
aaaaacaactgtatatcgggccacaacgtattccaccgagccgtcaccgaccctgcagtg
aacggcgacctccgagccctgcgctacttgagggcccaggagctgcagtgctcgactact
ccacacggggagcgggtgcagtccgacattaggccgtacatgaggagattactggcgatg
tggatgtttcaggtgtgtgaggagcagaaatgtgaggaggaggtgttcccactggccatg
cattatctagactcctacctaaggcagtttaccattgagaaagaaagactgcagctctta
gggactgtctgcatgttcttggcttcaaaaatgagagagacagtctccctaactgtaaac
accctttgtatctacgctgacaactccatctcagccacagacatcctgcagtgggagatg
ttggtggtgtccagattggactggtgtctggcctctgtgattccctccgacttcctggaa
ccaattcttcatgccttaccctttgttcagcccatgcactttcaaaacatgcgcaggcat
gttcactgctacattgctctggctgccactgacgacaggttctccgtgttcatgccctcc
actcttgcatgcgcctgtatcagccttgctgtgcagggggtaaaatcagcagacgctaac
accagtcctgagatagtgacgaagtttttggctgacctcctgtgcatcgatctgaactcc
atctgtctctgctgtgagcagctcaggagtctgctggagcacagcctaccctcctgtttt
aggagcggcagtaaagtaaaaacacgtggctcagagatcagctacacccctggtgactct
cagcatgttgcagccacaccaaagaatttaccttcctctgtcacaaacaagagtggaaga
atggaatag

KEGG   Cynoglossus semilaevis (tongue sole): 103392544
Entry
103392544         CDS       T04866                                 

Definition
(RefSeq) G1/S-specific cyclin-D1-like
  KO
K10151  G1/S-specific cyclin-D2
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04340  Hedgehog signaling pathway
csem04510  Focal adhesion
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103392544
   04340 Hedgehog signaling pathway
    103392544
   04068 FoxO signaling pathway
    103392544
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103392544
   04115 p53 signaling pathway
    103392544
   04218 Cellular senescence
    103392544
  09144 Cellular community - eukaryotes
   04510 Focal adhesion
    103392544
SSDB
Motif
Pfam: Cyclin_N Cyclin_C K-cyclin_vir_C
Other DBs
NCBI-GeneID: 103392544
NCBI-ProteinID: XP_008327395
UniProt: A0A3P8WXM4
LinkDB
Position
17
AA seq 340 aa
MEDLQGCQLKDTTSAGFCTHRVVQMDLSLWCEEVDDDLRQEQVQNLEPVARGSTPLRATW
DPTVSGNRVIQKLLHVEERYLPSALYIALIQRNPQQREELTKWALDVCFECGCDEAVFPL
SISLIDRFLSASLSLPISPYCLAAGCILIASKLIECDNVTADALCAAVENNFEASSLREM
ERVILATLRWDTAAVTPQDFLPHFLVSVAEGERARGNDTNEEDEEELLSTLRRHSDTLAV
MCVCDSRFLGVPPSLVAAASLVCALRGLGKKGVTQLERTSETLAELCQSDLAVLQYYSEM
IEYGLHHRLRSSPQIGPSEKDEEVEDERARTPTDMREINF
NT seq 1023 nt   +upstreamnt  +downstreamnt
atggaagatctacagggatgtcaactaaaggacaccacttctgccgggttttgcacacac
cgagtcgttcagatggatctgtctctctggtgtgaagaggtggacgatgacctcagacag
gagcaggtgcaaaatctggagcccgtcgccaggggctcaacgccgttgcgagccacctgg
gaccccacggtgtccggaaaccgcgtgattcaaaaacttcttcacgtagaggagcgatac
ctgccctccgcactctacatcgctctcatccagagaaatccacagcaaagggaggagctc
actaaatgggccctggatgtgtgctttgaatgcggctgtgatgaagctgtcttccctctg
tccatctctctgattgacaggttcctgtctgcctccttgtccttgcctatctcaccatac
tgcctggctgcaggctgcatccttattgcctccaaactcatagaatgtgacaacgttaca
gctgacgcgctttgtgcggccgttgagaacaactttgaggcgtcgagcttgagggaaatg
gagcgtgtcattctggccaccctcaggtgggacacagcggctgtaactcctcaggacttc
cttccacacttccttgtttctgtggcagagggagaaagagcaagaggaaatgacaccaat
gaagaagacgaagaggagctgctgtctaccctcaggagacacagtgacaccttggctgtt
atgtgtgtctgcgactcccgctttttgggagttccaccttccctcgtggctgctgcctcc
ctggtctgtgcgttaagaggtctgggcaaaaaaggggttactcagctggaacgcacaagc
gaaacattggcggagttgtgccagagcgacctggcggtgctgcaatactacagtgaaatg
attgaatacggccttcatcaccggctaaggagtagccctcagataggtccctcagagaag
gacgaggaagtagaagacgagagagccaggacgccaactgacatgagggagatcaacttt
taa

DBGET integrated database retrieval system