KEGG   Cynoglossus semilaevis (tongue sole): 103379082
Entry
103379082         CDS       T04866                                 

Definition
(RefSeq) mothers against decapentaplegic homolog 3 isoform X1
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04144  Endocytosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04371  Apelin signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103379082
   04350 TGF-beta signaling pathway
    103379082
   04371 Apelin signaling pathway
    103379082
   04068 FoxO signaling pathway
    103379082
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103379082
  09143 Cell growth and death
   04110 Cell cycle
    103379082
   04218 Cellular senescence
    103379082
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103379082
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103379082
NCBI-ProteinID: XP_008308728
UniProt: A0A3P8VZI7
LinkDB
Position
5
AA seq 425 aa
MSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELERAITTQNIN
TKCITIPRSLDGRLQVSHRKGLPHVIYCRLWRWPDLQSHHELRAVEMCEYAFHTKKDEVC
VNPYHYQRVETPVLPPVLVPRHTEIPSEFPPLDDYSHSIPENTNFPAGIEPQSNYIPETP
PPGYLSEDGETSDHQMTHSMDTSSPNLSPNPVSPTHSNLDLQPVTYCEPAFWCSISYYEL
NQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNPSVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLTQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIR
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtcaattctgcctttcactccccccattgtcaagagacttttgggctggaagaaagga
gagcagaacggccaggaggagaagtggtgtgagaaagccgtgaaaagtctggtgaagaag
ctgaagaagaccgggcagctggacgagctggagcgagccatcaccacccagaatatcaac
acgaaatgcatcaccataccgaggtccctcgatggccgtctccaggtgtcccacagaaaa
ggcctcccccatgtcatatactgtcgtctgtggcgctggccggacctgcagtcacaccac
gagctgcgggcggtggagatgtgcgagtacgccttccacacaaagaaggacgaagtgtgc
gtcaacccgtaccactaccagagagtggagacaccagtcctccctcccgtgctggtgccc
agacacacagagattcccagtgagttcccaccacttgatgactacagccattcaatccct
gaaaacaccaacttcccagctgggattgagccccaaagcaactacatcccagaaacgcca
ccacctggttacctgagtgaggatggagagaccagcgatcaccagatgacccacagcatg
gacaccagctctccaaacctgtctccaaaccctgtttcaccaacacacagcaacctagac
cttcagccagtcacctactgcgagccggccttctggtgctctatttcatactacgagctg
aatcaacgagtaggggagaccttccacgcctcgcagccctcgctgacggttgacggtttc
acggacccctccaactctgagcgtttctgcctcgggctgttgtccaacgtcaaccggaac
ccgtcggtggagttaacacgcagacatatcggccgtggtgtgaggctgtactacatcgga
ggagaagtatttgccgagtgtctcagtgacagcgccatctttgtccaaagccccaactgt
aaccagcgctacggctggcatcctgccacggtctgcaaaatccctccaggctgtaacctg
aagattttcaacaaccaggagtttgctgcactgctgacccagtcagtcaaccagggcttc
gaggctgtttaccagctgaccaggatgtgcaccatccgcatgagctttgtcaaaggctgg
ggagcggagtacagacgacagacggtgaccagcaccccctgctggatcgagctgcacctg
aacggccccctgcagtggctggacaaggtgctcacacagatgggctcccccagcatccgc
tgctccagcgtctcctag

KEGG   Cynoglossus semilaevis (tongue sole): 103380246
Entry
103380246         CDS       T04866                                 

Gene name
smad3
Definition
(RefSeq) mothers against decapentaplegic homolog 3
  KO
K23605  mothers against decapentaplegic homolog 3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04144  Endocytosis
csem04218  Cellular senescence
csem04310  Wnt signaling pathway
csem04350  TGF-beta signaling pathway
csem04371  Apelin signaling pathway
csem04520  Adherens junction
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04310 Wnt signaling pathway
    103380246 (smad3)
   04350 TGF-beta signaling pathway
    103380246 (smad3)
   04371 Apelin signaling pathway
    103380246 (smad3)
   04068 FoxO signaling pathway
    103380246 (smad3)
 09140 Cellular Processes
  09141 Transport and catabolism
   04144 Endocytosis
    103380246 (smad3)
  09143 Cell growth and death
   04110 Cell cycle
    103380246 (smad3)
   04218 Cellular senescence
    103380246 (smad3)
  09144 Cellular community - eukaryotes
   04520 Adherens junction
    103380246 (smad3)
SSDB
Motif
Pfam: MH2 MH1 IRF-3
Other DBs
NCBI-GeneID: 103380246
NCBI-ProteinID: XP_008310325
UniProt: A0A3P8VEX9
LinkDB
Position
6
AA seq 425 aa
MSILPFTPPIVKRLLGWKKGEQNGQEEKWCEKAVKSLVKKLKKTGQLDELEKAITTQNVN
TKCITIPRSLDGRLQVSTRKGLPHVIYCRLWRWPDLQSHHELRAVDHCEFAFHTKKDEVC
VNPYHYQRVETPILPPVLVPRHTDIPAVFPPLDDYSPSIPENTNFPAGIEPQSNYIPETP
PPGYLSEDGETSDHQLNHSMDTSSPSLSPNPISPSNSNLGLQPVTYCESAFWCSISYYEL
NQRVGETFHASQPSLTVDGFTDPSNSERFCLGLLSNVNRNSAVELTRRHIGRGVRLYYIG
GEVFAECLSDSAIFVQSPNCNQRYGWHPATVCKIPPGCNLKIFNNQEFAALLAQSVNQGF
EAVYQLTRMCTIRMSFVKGWGAEYRRQTVTSTPCWIELHLNGPLQWLDKVLTQMGSPSIH
CSSVS
NT seq 1278 nt   +upstreamnt  +downstreamnt
atgtccatattaccgttcacccctcctatagtgaagaggctcctcggctggaagaaaggg
gagcagaacggacaagaggagaaatggtgcgaaaaggctgtaaaaagtctcgtgaagaag
ttgaagaaaactggacaactggacgagttggagaaagccatcacgacacagaatgtcaac
acgaaatgcatcaccatacccagatctctagatggccgtctccaggtctccaccagaaaa
ggtctccctcatgtgatctactgccgtttatggcgctggcccgatctacagtcccaccat
gagttaagagctgtcgaccactgtgaatttgcctttcataccaagaaggatgaagtctgt
gtcaatccctaccactaccagagggtggagacaccaattctgcctcctgtcctcgtacca
cggcacacagacatccctgcagtgtttccaccgctggatgactacagtccatccattcct
gagaacacaaatttccctgctggcattgagccccaaagtaactatattcctgaaacaccc
ccaccaggctaccttagtgaagatggtgagaccagtgaccaccagctcaaccacagcatg
gataccagttcacccagtctgtcacccaatcctatatcaccctcaaacagtaatcttggc
ttacaacctgtgacctactgtgaatcggccttctggtgctctatatcctactatgaactg
aaccaacgtgttggagagaccttccatgcgtctcagccctccctcactgtagatggcttc
actgacccatccaactctgagcgcttctgtctcggtctgctgtcaaacgtcaaccgcaac
tcagcagttgagctcacgcgcagacacataggaaggggcgtcaggttgtactacattggg
ggcgaggtgtttgcagagtgtctcagtgacagtgccatatttgttcaaagtccaaactgc
aatcagcgctacggctggcatcctgccactgtttgcaaaattcctccaggttgtaatttg
aagatcttcaacaaccaggagtttgctgctctactcgcccagtctgtcaaccagggattt
gaggctgtttaccaacttaccagaatgtgcaccatccgtatgagcttcgttaaaggatgg
ggagcagagtacagacgtcagactgtgactagcaccccttgttggatagaactgcatctc
aacggtcctctgcagtggctggataaggtcctcacacagatggggtctccgagcatccac
tgctccagtgtgtcgtag

DBGET integrated database retrieval system