KEGG   Cynoglossus semilaevis (tongue sole): 103379132Help
Entry
103379132         CDS       T04866                                 

Gene name
hk1
Definition
(RefSeq) hexokinase-1
  KO
K00844  hexokinase [EC:2.7.1.1]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00010  Glycolysis / Gluconeogenesis
csem00051  Fructose and mannose metabolism
csem00052  Galactose metabolism
csem00500  Starch and sucrose metabolism
csem00520  Amino sugar and nucleotide sugar metabolism
csem00524  Neomycin, kanamycin and gentamicin biosynthesis
csem01100  Metabolic pathways
csem01200  Carbon metabolism
csem04910  Insulin signaling pathway
Module
csem_M00001  Glycolysis (Embden-Meyerhof pathway), glucose => pyruvate
csem_M00549  Nucleotide sugar biosynthesis, glucose => UDP-glucose
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    103379132 (hk1)
   00051 Fructose and mannose metabolism
    103379132 (hk1)
   00052 Galactose metabolism
    103379132 (hk1)
   00500 Starch and sucrose metabolism
    103379132 (hk1)
   00520 Amino sugar and nucleotide sugar metabolism
    103379132 (hk1)
  09110 Biosynthesis of other secondary metabolites
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    103379132 (hk1)
 09150 Organismal Systems
  09152 Endocrine system
   04910 Insulin signaling pathway
    103379132 (hk1)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   04131 Membrane trafficking [BR:csem04131]
    103379132 (hk1)
Enzymes [BR:csem01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.1  hexokinase
     103379132 (hk1)
Membrane trafficking [BR:csem04131]
 Autophagy
  Mitophagy
   Other mitophagy associated  proteins
    103379132 (hk1)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Hexokinase_2 Hexokinase_1 CSD NYD-SP28
Motif
Other DBs
NCBI-GeneID: 103379132
NCBI-ProteinID: XP_008308805
LinkDB All DBs
Position
5
AA seq 918 aa AA seqDB search
MIAAQLLAYYFTELKDDQVKKIDKYLYSMRFSDETLLDITQRFRMELANGLGRDTNPTAV
LKMLPTFVRSIPDGSEKGDFIALDLGGSNFRILRVKVSHEKKQTVQMESQIYNTPEDIIH
GTGTRLFDHVAECLGDFIEKHDIKEKKLPVGFTFSFPCQQTKLDESYLITWTKRFKASGV
EGMNVVELLNKAIKKKGTYEADIMAVVNDTVGTMMTCGFDDQRCEVGIIIGTGTNACYME
ELRHIDLVEGDEGRMCVNTEWGAFGDDGRLEDIRTEFDREIDRGSLNPGKQLFEKMVSGM
YLGELVRLILVKMAREGMLFEGRITPELLTRGTFETKHISAIEKNKEGLCKAKEILTKLG
VEPSDEDCIAVQHVCAIVSFRSANLIAAVLAGILKRLKENKGVSRLRTTVGIDGSLYKMH
PQYARRLHKTVRRLVPDSDVRFLLSESGSSKGAAMVTAVAYRLANQSQEIKEMLSEFRLT
NDQLLEVKNRMTSEMQKGLSKSTQESATMKMLPTFVCSTPDGTEYGDFLALDLGGTNFRV
LLVKIRSGKKKSVEMHNKIYAIPLEVMQGTGEELFDHIVQCISDFLDYMGMKNARLPLGF
TFSFPCKQTSLDAGILLTWTKGFKATDCEGEDVVGLLREAIKRREEFDLDVVAVVNDTVG
TMMTCAYEEPTCQIGLIAGTGSNACYMEDMRNIEMIEEDKGQMCINMEWGAFGDNGCLDD
IRTEYDRNVDDFSLNPGKQRYEKMCSGMYLGEIVRNILIDMTKRGFLFRGQISETLKTRG
IFETKFLSQIESDRLALLQVRSILQHLGLDSTCDDSIIVKEVCEAVSRRAAQLCGAGMAA
VADKIRKNRGKDHLEIIVGVDGTLYKLHPHFSRIMHQTVKELAPQCDVNFLLSEDGSGKG
AALITAVGCRLRQELNNK
NT seq 2757 nt NT seq  +upstreamnt  +downstreamnt
atgattgcagcccagctattggcttattacttcactgaactcaaggatgaccaggtcaag
aagattgataagtacctctactccatgcgtttctctgatgagactttactggacatcaca
cagcggtttcgcatggagctggccaacggactgggccgggacacaaaccccacagctgta
ctgaagatgctgcccacatttgtgcgatcgatccccgatggctcagagaaaggcgacttc
atcgctctggacctgggcggcagtaacttcaggattcttcgtgtgaaagtgagccatgag
aagaaacaaaccgttcagatggagagtcaaatctacaacacaccagaggacatcatccac
ggaactggaaccagactgtttgaccatgtggccgaatgcctgggtgacttcatagaaaag
cacgacattaaagagaagaaacttccagtagggttcaccttctctttcccctgtcagcag
accaaactggacgagagctatctaataacatggacaaagcgcttcaaggctagtggagtt
gaaggaatgaacgtcgtggagctactgaacaaagccatcaagaaaaaagggacttatgaa
gctgacatcatggctgtagtcaatgatacagttgggacaatgatgacctgtggttttgac
gaccaacgctgtgaagttggaatcatcattggcacaggcaccaacgcctgctacatggag
gagctgcgtcacattgacctggtggaaggagacgagggcaggatgtgtgtgaacacggag
tggggagcatttggagacgacggccggctggaagacatcaggacagagttcgacagagaa
atagacagaggttctctcaaccccgggaaacagctatttgagaagatggtgagtgggatg
tacctgggggagctggtccgtctcatactggtgaagatggccagagagggaatgctgttt
gaaggaaggatcaccccggagcttctgaccagagggacgtttgaaaccaaacacatctca
gccattgaaaagaataaggagggactgtgcaaagccaaagagattttaaccaaactgggt
gtggagccctctgatgaggactgtattgctgtgcagcacgtgtgtgccattgtgtccttc
cgctctgctaaccttatagctgctgtgctagctggtattctgaagagactgaaggaaaac
aaaggtgtttcccgactacgcaccactgtaggcattgacggctctctctacaaaatgcac
ccgcaatatgcccgtcgccttcacaagacggtccgtcgtttggtcccggactctgacgtg
cgtttcctcctgtcagagagcggcagcagtaaaggagcggccatggtcacggctgtagcc
tacagactggccaaccagtcacaggaaatcaaagaaatgctgtcggagtttcgattgacc
aatgaccagctgctggaggtgaaaaatcgaatgacaagtgaaatgcaaaaaggcctttca
aagagcactcaggaatctgctaccatgaagatgttgccaaccttcgtctgcagcactcct
gacggcacagagtacggtgatttcctggccttggatttagggggaacaaacttcagagtt
ctgttggtcaagatccgttcgggcaagaagaaatccgtggagatgcacaacaagatttat
gccattcctctggaagtgatgcagggcacaggagaggagctgtttgatcacattgtacag
tgcatcagtgacttcctggactacatgggtatgaagaacgctcgtctgcctctgggcttc
accttctccttcccctgcaaacagaccagcctggatgctggcatcctactgacgtggacc
aaaggcttcaaggccacagactgtgaaggagaggatgtggtgggactgttgagagaagcc
atcaagaggagagaggagtttgacctggatgtggtggccgtcgtcaacgacaccgtggga
accatgatgacctgcgcctacgaagaacctacctgtcagattggactcatcgctggcact
ggcagtaacgcctgttacatggaggacatgaggaacatcgagatgatcgaggaagacaag
ggacagatgtgcatcaacatggagtggggagccttcggagacaacggatgtctggacgac
atcaggacggaatatgatcgcaatgtggacgacttctctctcaatccaggcaaacaaagg
tatgagaagatgtgcagtggcatgtacctgggagaaatcgtgcgaaacatcctcatagac
atgaccaagagaggattcctgttccgagggcagatctctgagaccctgaagaccagaggc
atctttgagacaaagtttctgtcccagatagagagtgacagactggctctgctgcaggtc
agatccatcctgcaacacctaggactggacagcacgtgtgatgacagtatcatagtcaaa
gaggtgtgcgaggcagtgtcacgtcgagcagctcagctgtgcggggcaggaatggcagcg
gtggccgataaaatccggaagaaccgtggaaaggaccatctggagatcattgttggtgtg
gatggaactctgtacaagcttcatccacacttttcccggattatgcaccagacggtgaag
gaactggctcctcagtgtgacgtgaacttcctgctgtcagaggacggcagcggtaaagga
gctgccctcatcacagctgtgggctgcagactgagacaggagctgaacaataaatag

DBGET integrated database retrieval system