KEGG   Cynoglossus semilaevis (tongue sole): 103379187
Entry
103379187         CDS       T04866                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103379187
   04068 FoxO signaling pathway
    103379187
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103379187
   04210 Apoptosis
    103379187
   04115 p53 signaling pathway
    103379187
   04218 Cellular senescence
    103379187
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103379187
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103379187
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103379187
SSDB
Motif
Pfam: Ribosomal_L7Ae DUF5768
Other DBs
NCBI-GeneID: 103379187
NCBI-ProteinID: XP_008308889
UniProt: A0A3P8UZ58
LinkDB
Position
1
AA seq 153 aa
MIPEENFETIENRTQSVSLALEELLVTALKQDCLTIGIYESAKLFNADPDSVVLCVLAAD
DEDDVALQIHFTLLQAFCCDSGITILRVSGVQRLQQLLGSVDANRNQDDHRDLHCMLVTN
HQADHCRLQEVGTYCQERRRLDQWVPELVLQER
NT seq 462 nt   +upstreamnt  +downstreamnt
atgattccagaggaaaacttcgaaaccatcgagaacaggacgcagtcagtcagtctggct
ctggaggagctgctggttacagctctgaaacaagactgtctcaccatcggcatctatgag
tcagccaaacttttcaatgctgatccggacagtgtggtcctctgtgtcctggcagcggat
gacgaagacgacgtggcgctgcagatccacttcaccctcctgcaggccttctgctgcgac
agcggcatcaccatcctacgagtgtccggcgtccagaggctgcagcagctgctgggctcg
gtggacgccaacaggaaccaggacgaccacagagaccttcactgcatgctggtcacgaac
caccaggctgaccactgtaggctgcaagaggtgggaacctactgccaggagaggcgacgc
ctggatcagtgggttcctgaactggtcctgcaagaacgatga

KEGG   Cynoglossus semilaevis (tongue sole): 103389087
Entry
103389087         CDS       T04866                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103389087
   04068 FoxO signaling pathway
    103389087
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103389087
   04210 Apoptosis
    103389087
   04115 p53 signaling pathway
    103389087
   04218 Cellular senescence
    103389087
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103389087
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103389087
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103389087
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103389087
NCBI-ProteinID: XP_008322574
UniProt: A0A3P8WLA4
LinkDB
Position
14
AA seq 141 aa
MQSPGKALQDTLLWAQSEQRLTVGVYESAKIMTEDPDSVSFCVLGTDEEFECDIALQIHF
TLIQSFCFDNDISIVRVSDTQRLAEIVGGDKVEQLEDAHCVLITNPVDGSWEDPALEKLH
LFCEESRRLNDWLPEINLPGR
NT seq 426 nt   +upstreamnt  +downstreamnt
atgcagtctcctggcaaagccctgcaggacactctgctgtgggctcagagcgagcagagg
ctcactgttggcgtctacgaaagcgcgaaaatcatgactgaagacccagacagcgtgtcc
ttctgcgtcctgggcacggacgaggagtttgagtgcgacatcgcgctgcagatccacttc
acactgatccagtccttctgcttcgacaacgacatcagcatcgtgcgcgtcagcgacaca
cagagactggctgagattgtcggcggagacaaagtcgagcaactggaagacgctcactgc
gtcctcatcacgaacccagttgatggttcttgggaggaccctgctctggagaaactgcac
ctgttctgtgaggagagccgtcgtcttaacgactggcttcctgagatcaacctccccggt
cgttga

KEGG   Cynoglossus semilaevis (tongue sole): 103389088
Entry
103389088         CDS       T04866                                 

Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 gamma-like
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103389088
   04068 FoxO signaling pathway
    103389088
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103389088
   04210 Apoptosis
    103389088
   04115 p53 signaling pathway
    103389088
   04218 Cellular senescence
    103389088
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103389088
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103389088
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103389088
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103389088
NCBI-ProteinID: XP_008322575
LinkDB
Position
14
AA seq 155 aa
MTLEEVQIQKPQERDQCVGQALEDVLVSAKDNDAPTVGVHECAKVMNLDPDSVSFCVLAT
DEEFECDIALQIHFTLIQSFCFDNDISIVRVSDTQRLAEIVGGDKVEQLEDAHCVLITNP
ADGSWEDPALEKLHLFCEESRHLNDWLPEINLPGR
NT seq 468 nt   +upstreamnt  +downstreamnt
atgactctggaggaagttcagatccagaaaccccaggaacgcgaccagtgtgtgggtcag
gccctggaggatgttctggtctctgcaaaagacaacgacgctcccaccgtgggcgtccac
gagtgcgccaaagtcatgaatctagacccagacagcgtgtccttctgcgtcctggccacg
gatgaggagtttgagtgcgacatcgcgctgcagatccacttcacactgatccagtccttc
tgcttcgacaacgacatcagcatcgtgcgcgtcagcgacacacagagactggctgagatt
gtcggcggagacaaagtcgagcaactggaagacgctcactgcgtcctcatcacgaaccca
gctgatggttcttgggaggaccctgctctggagaaactgcacctgttctgtgaggagagc
cgtcatcttaacgactggcttcctgagatcaacctccccggtcgttga

KEGG   Cynoglossus semilaevis (tongue sole): 103396087
Entry
103396087         CDS       T04866                                 

Gene name
gadd45a
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 alpha isoform X1
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103396087 (gadd45a)
   04068 FoxO signaling pathway
    103396087 (gadd45a)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103396087 (gadd45a)
   04210 Apoptosis
    103396087 (gadd45a)
   04115 p53 signaling pathway
    103396087 (gadd45a)
   04218 Cellular senescence
    103396087 (gadd45a)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103396087 (gadd45a)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103396087 (gadd45a)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103396087 (gadd45a)
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103396087
NCBI-ProteinID: XP_008332266
UniProt: A0A3P8WMJ2
LinkDB
Position
20
AA seq 163 aa
MYTMTFEELNGEYPQERMDSVAKALEEVLASALPQGCITVGVYEAAKSLNVDPDNVVLCI
LATDDEDVKDVALQIHFTLIQAFCCENDINILRVNNTRRLAEILGGGAAGKQSGGEPMDL
HCVLVTNPHSTLWKDPALSKVNRFCRESRCMDQWVPIINLPER
NT seq 492 nt   +upstreamnt  +downstreamnt
atgtacaccatgacatttgaggaactaaacggagaatatccgcaggaaagaatggattca
gtggcgaaagctttagaagaagtgctcgcgtcagcgttaccacagggctgcatcacagtc
ggagtgtacgaagctgccaagtctctgaatgtagaccctgataatgtggttttgtgcatc
ctggccaccgatgacgaagacgtcaaagacgtggccttgcagattcacttcacccttatt
caggcattctgctgcgaaaatgacatcaacatcctgagagtgaacaacacccggcgtctg
gcagagattctgggtggaggagctgcagggaaacagagcgggggagaacccatggactta
cactgtgtcctggtcactaacccacattccacattgtggaaagaccctgctctgagcaaa
gtgaaccgattctgcagagagagtcgctgcatggaccagtgggtgcccatcatcaacctg
cctgaacgatga

KEGG   Cynoglossus semilaevis (tongue sole): 103396969
Entry
103396969         CDS       T04866                                 

Definition
(RefSeq) uncharacterized protein LOC103396969
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103396969
   04068 FoxO signaling pathway
    103396969
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103396969
   04210 Apoptosis
    103396969
   04115 p53 signaling pathway
    103396969
   04218 Cellular senescence
    103396969
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103396969
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103396969
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103396969
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103396969
NCBI-ProteinID: NP_001288109
UniProt: A0A075EYB0
LinkDB
Position
W
AA seq 159 aa
MTLEEVHRQDNTTENSDRVQSAGEALEELLVAAKKQDYLTVGVYESAKVMNVDPDSVAFC
VLATDEEYECDIALQIHFTLIQAFCFENDINVVRVSDMQRLADLVRADETGEPKDPHCIL
VTSPSANPWKDPALDKLSLFCEESRSVYDWVPSITLPKR
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagaggttcacagacaagacaacacgacggaaaacagtgacagggtgcaa
agtgcaggcgaagcgctggaagagctgctggtcgccgccaagaagcaggactacctgaca
gttggagtctacgagtccgccaaagtcatgaatgttgacccagacagcgttgcattctgc
gtcctggccacggatgaggagtacgagtgtgacatcgcgctccagatccactttaccctc
atccaggcgttctgcttcgagaacgacatcaacgttgtgcgcgtcagcgacatgcagcgc
ctggcagacctcgtgcgcgcagacgaaaccggcgagcccaaggacccgcactgcattctt
gtcacgagtcccagtgcaaacccatggaaggatcctgctctggacaagctgtctctgttc
tgcgaggagagccgcagcgtgtacgactgggtgcccagcatcactctcccaaagcgctga

KEGG   Cynoglossus semilaevis (tongue sole): 103397674
Entry
103397674         CDS       T04866                                 

Definition
(RefSeq) uncharacterized protein LOC103397674
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103397674
   04068 FoxO signaling pathway
    103397674
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103397674
   04210 Apoptosis
    103397674
   04115 p53 signaling pathway
    103397674
   04218 Cellular senescence
    103397674
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103397674
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103397674
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103397674
SSDB
Motif
Pfam: Ribosomal_L7Ae
Other DBs
NCBI-GeneID: 103397674
NCBI-ProteinID: NP_001288108
UniProt: A0A075F1E4
LinkDB
Position
Z
AA seq 159 aa
MTLEEFHGQDNTMENSDRLQSAGTALEELLVAAKNRDYLTVGVYESAKVMNVDPDSVAFC
VLATDEEYKCDIALQIHFTLIQAFCFENDINVVRVNDIQRLADLVGADETGEPKDAHCIL
VTSPSANPWKDPALDKLALFCKESRSVYDWVPSITLPER
NT seq 480 nt   +upstreamnt  +downstreamnt
atgactctggaagagtttcacggacaagacaacacgatggaaaacagtgacaggctgcaa
agtgcagggacagcgctggaagagctgctggtcgccgccaagaatcgggactacctgacg
gttggagtctacgagtccgccaaagtcatgaatgttgacccagacagcgtggcattctgc
gtcctggccacggatgaggagtacaagtgtgacatcgcgctccagatccacttcaccctc
atccaggcgttctgctttgagaacgacatcaacgtcgtgcgtgtcaacgacatccaacgc
ctggcagacctcgtgggcgcagacgaaaccggcgagccaaaggacgctcactgcattctt
gtcacgagtcccagtgcaaacccatggaaggatcccgctctggacaagctggctctgttt
tgcaaggagagccgcagcgtgtacgactgggtgcccagcatcacccttccagagcgctga

KEGG   Cynoglossus semilaevis (tongue sole): 103398452
Entry
103398452         CDS       T04866                                 

Gene name
gadd45b
Definition
(RefSeq) growth arrest and DNA damage-inducible protein GADD45 beta
  KO
K04402  growth arrest and DNA-damage-inducible protein
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
csem04115  p53 signaling pathway
csem04210  Apoptosis
csem04218  Cellular senescence
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103398452 (gadd45b)
   04068 FoxO signaling pathway
    103398452 (gadd45b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103398452 (gadd45b)
   04210 Apoptosis
    103398452 (gadd45b)
   04115 p53 signaling pathway
    103398452 (gadd45b)
   04218 Cellular senescence
    103398452 (gadd45b)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03036 Chromosome and associated proteins [BR:csem03036]
    103398452 (gadd45b)
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic type
  Centrosome formation and ciliogenesis proteins
   Centrosome duplication proteins
    Other centrosome duplication proteins
     103398452 (gadd45b)
  Sister chromatid separation proteins
   Aurora kinases
    Regulators of Aurora kinases
     103398452 (gadd45b)
SSDB
Motif
Pfam: Ribosomal_L7Ae SAB
Other DBs
NCBI-GeneID: 103398452
NCBI-ProteinID: XP_008335309
UniProt: A0A3P8UJ06
LinkDB
Position
2
AA seq 163 aa
MLDYFRMTLEEMMKRNNNITEMKTVGSALEDLLVTAQNQDRLTVGVYESAKLMTVDPDSV
VLCVLATDEEDEGDIALQIHFTLLQAFCCDNDIDILRVSGARRLAKVLREDREDSNGNEP
RDLHCILVTNPPLQCSSLQDISSFCEESRYRNQWVPFLQLQDR
NT seq 492 nt   +upstreamnt  +downstreamnt
atgctggattatttcaggatgacgctggaagaaatgatgaagaggaacaacaatatcact
gagatgaagactgtgggttcggctctggaggacctacttgtcacggctcagaaccaggac
cggctgacggtgggagtctacgagtccgccaaactcatgactgttgacccagacagcgtg
gttctgtgcgtcctggctacagacgaggaggacgaaggtgacatcgctctgcagattcac
ttcacactactgcaggcattctgctgtgacaacgacatcgacatcctgcgagtgtccggc
gcccggcgactggctaaggttctgcgggaggacagagaagacagcaacggcaacgagcct
cgagacctgcactgcatcctggtcacgaacccgccattgcagtgctcttctcttcaggat
atcagcagcttctgtgaggagagtcgctacaggaaccagtgggtaccatttctacagctg
caggatcgctga

DBGET integrated database retrieval system