KEGG   Cynoglossus semilaevis (tongue sole): 103379247Help
Entry
103379247         CDS       T04866                                 

Definition
(RefSeq) histone H3
  KO
K11253  histone H3
Organism
csem  Cynoglossus semilaevis (tongue sole)
Brite
Chromosome and associated proteins [BR:csem03036]
 Eukaryotic Type
  Nucleosome assembly factors
   Histones
    103379247
Exosome [BR:csem04147]
 Exosomal proteins
  Exosomal proteins of haemopoietic cells  (B-cell, T-cell, DC-cell, reticulocyte, and mast cell)
   103379247
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: Histone CENP-T_C CENP-S CBFD_NFYB_HMF PAF TFIID-31kDa
Motif
Other DBs
NCBI-GeneID: 103379247
NCBI-ProteinID: XP_008308957
LinkDB All DBs
Position
5
AA seq 136 aa AA seqDB search
MARTKQTARKSTGGKAPRKQLATKAARKSAPATGGVKKPHRYRPGTVALREIRRYQKSTE
LLIRKLPFQRLVREIAQDFKTDLRFQSSAVMALQEASEAYLVGLFEDTNLCAIHAKRVTI
MPKDIQLARRIRGERA
NT seq 411 nt NT seq  +upstreamnt  +downstreamnt
atggcccgtactaaacaaaccgcccgtaaatccaccggaggtaaagctcctaggaagcag
ctcgccaccaaggctgcccgtaaaagcgccccggctaccggcggtgtgaagaagcctcat
cgttacaggcccggtaccgttgctctgcgtgagatccgtcgttatcagaaatccacggag
cttctcatccgtaagctgcctttccagcggctggtcagagagatcgctcaggacttcaag
accgacctgcgcttccagagctccgccgtcatggctctgcaggaggccagcgaggcttac
ctggtgggtctgttcgaggacaccaacctgtgcgccatccacgccaagagagtcaccatc
atgcccaaagacatccagctggcccgtcgtatccgcggggagagggcgtag

DBGET integrated database retrieval system