KEGG   Cynoglossus semilaevis (tongue sole): 103379524
Entry
103379524         CDS       T04866                                 

Gene name
kitlg
Definition
(RefSeq) kit ligand
  KO
K05461  KIT ligand
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04010  MAPK signaling pathway
csem04916  Melanogenesis
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04010 MAPK signaling pathway
    103379524 (kitlg)
 09150 Organismal Systems
  09152 Endocrine system
   04916 Melanogenesis
    103379524 (kitlg)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   04052 Cytokines and growth factors [BR:csem04052]
    103379524 (kitlg)
Cytokines and growth factors [BR:csem04052]
 Growth factors
  Growth factors (RTK binding)
   103379524 (kitlg)
SSDB
Motif
Pfam: SCF DASH_Dad4
Other DBs
NCBI-GeneID: 103379524
NCBI-ProteinID: XP_008309318
UniProt: A0A3P8X2D1
LinkDB
Position
6
AA seq 267 aa
MKRSKIWIRVCVYLLLFITLEVHSSKFDVNPVTDDITTLAILRHNIPEDYKIPVRYVPKE
EGVMCWVKLNVYYLEESLTDLSQKFGNISTNRKDISIFIQMLQELRLNMGSLEPIMFEFE
CHYREEKWQTARYFDFVKTFLLAAQNREDSDDCTPLPCPTTPYQAEEYLKESPMSATEDP
VYSPVGNDTLREGRLMSAVLERSLFSLLLIPLLGLICLIVWKIRSRRTLEDPEQNPAANR
LYSEPEWALPPLDQTTEKNKLNVIASV
NT seq 804 nt   +upstreamnt  +downstreamnt
atgaagaggtcaaaaatttggatacgtgtctgtgtctatttactgctgttcatcacgctt
gaagtgcactcaagtaaatttgacgtcaacccagtgacagatgacatcactacccttgct
attttgagacataatattccagaagattataaaattcctgttcgttacgttccaaaggaa
gagggtgtaatgtgttgggtcaaattaaacgtctactacttggaggagagtttaacggat
ttatcccaaaagtttggaaacatttcaaccaacagaaaagacattagcatattcatacaa
atgctccaagaactgaggctcaacatggggtccttggagccaatcatgtttgagtttgag
tgccactacagggaggagaagtggcagactgcacgatactttgactttgtcaaaaccttc
cttttagctgcacagaatagagaagactcagacgactgcacccccctcccctgtcccacc
acaccataccaagcagaagaatatttaaaggagtcacccatgtctgccactgaagacccc
gtgtattcaccagttggcaacgacacattaagagaagggagactcatgtccgcggtgctg
gagcgaagcctgttctctttattgctcattccactcctaggcctcatatgtctgattgtg
tggaagatccgatcacggagaactctggaggatccggaacagaaccccgcagcaaacaga
ctgtactcagaaccagaatgggccttacctccactggaccaaacaacagagaagaacaag
ttaaacgtcattgcatcagtgtaa

DBGET integrated database retrieval system