KEGG   Cynoglossus semilaevis (tongue sole): 103380276Help
Entry
103380276         CDS       T04866                                 

Gene name
fads2
Definition
(RefSeq) LOW QUALITY PROTEIN: fatty acid desaturase 2
  KO
K10226  acyl-CoA 6-desaturase (Delta-6 desaturase) [EC:1.14.19.3]
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem00592  alpha-Linolenic acid metabolism
csem01040  Biosynthesis of unsaturated fatty acids
csem01100  Metabolic pathways
csem01212  Fatty acid metabolism
csem03320  PPAR signaling pathway
Brite
KEGG Orthology (KO) [BR:csem00001]
 09100 Metabolism
  09103 Lipid metabolism
   00592 alpha-Linolenic acid metabolism
    103380276 (fads2)
   01040 Biosynthesis of unsaturated fatty acids
    103380276 (fads2)
 09150 Organismal Systems
  09152 Endocrine system
   03320 PPAR signaling pathway
    103380276 (fads2)
 09180 Brite Hierarchies
  09181 Protein families: metabolism
   01004 Lipid biosynthesis proteins [BR:csem01004]
    103380276 (fads2)
Enzymes [BR:csem01000]
 1. Oxidoreductases
  1.14  Acting on paired donors, with incorporation or reduction of molecular oxygen
   1.14.19  With oxidation of a pair of donors resulting in the reduction of O2 to two molecules of water
    1.14.19.3  acyl-CoA 6-desaturase
     103380276 (fads2)
Lipid biosynthesis proteins [BR:csem01004]
 Desaturase
  Front-end
   103380276 (fads2)
BRITE hierarchy
SSDB OrthologParalogGFIT
Motif
Pfam: FA_desaturase Cyt-b5 CHDNT MpPF26 DUF4133
Motif
Other DBs
NCBI-GeneID: 103380276
NCBI-ProteinID: XP_008310383
LinkDB All DBs
Position
6
AA seq 451 aa AA seqDB search
MRLSRGGGGGGGRLTEPGDGGSGLTGGVYTWXXXXXXXXXXQWLVIDRKVYNTTEWAKRH
PGGYRVISHYAGQDASEAFTAFHPDLTFVKKFLKPLLVGELAPSEPSQDRNKNAALIQDF
RTLRNEAEKKGLFRARPLFFYLHLGHIVLLEAFAWFMIWFWGTNWILTILCVVMLTVVQS
QAGWLQHDFGHLSVFPNSHWNHLLQKFIIGHLKGASANWWNHRHFQHHAKPNIFKKDPDV
NMLNMFVLGDTQPVEYGIKKIKRMPYHRQHQYFFLVGPPLLIPVFFHSQIMRTMISRHDW
VDLVWSLSYYLRYFSCYIPLYGLFGSLALITFVRFLESHWFVWVTQMNHLPMDIDYEKHQ
DWLTTQLQATCNVEQSPFNDWFSGHLNFQIEHHLFPLMPRHNYHLVAPQVRSLCAKYEIP
YEVKTLWRGLADVVRSLKSSGDLWLDAYLHK
NT seq 1356 nt NT seq  +upstreamnt  +downstreamnt
atgaggttaagcagaggaggtggcggaggaggaggccggttgacggagccaggagacgga
ggcagcgggctgacaggaggtgtctacacctggnngnnnnnnnnnnnnnnnnnnnnnnnn
nnccagtggctggttatagatcgaaaggtttacaacaccacagagtgggccaaaagacat
ccaggagggtatcgagtcattagccactacgctggacaggacgcctcagaggcattcact
gcttttcatccagatttgacctttgtgaaaaagtttctgaagcccctgctggttggagag
ttagcgccttcagaacccagccaggaccgaaataaaaatgcagcgttaatccaggatttc
cgcactttacgcaacgaggcagagaaaaaaggtctgttccgagctcgccctttgttcttc
tacctccacctgggacacatcgtgctgctggaggcttttgcctggtttatgatatggttt
tggggaactaactggattctgaccatcctctgtgtcgtcatgttgacagttgttcagtcc
caggctggatggctgcagcacgacttcggccacctgtctgtcttcccaaactcccactgg
aatcatttgctgcagaagtttatcattggccatttaaagggagcttctgccaactggtgg
aaccatcgacatttccagcatcatgcaaagcccaacatttttaaaaaagaccccgacgtc
aacatgttgaacatgttcgtacttggtgacacgcagccggtggaatacggaatcaagaag
atcaaacgtatgccctaccatcgacagcaccagtacttctttcttgttggacctccgctg
cttattccagtttttttccacagtcagataatgcgcactatgatctctcgtcacgactgg
gtggatttggtctggtctctgtcctactaccttcgctacttcagctgttacataccgctg
tacggcctgtttggttccctagccctgatcacatttgtcaggtttctggagagccactgg
ttcgtgtgggtcacccagatgaatcatctgcccatggacattgactatgagaaacaccaa
gactggttaaccacgcagcttcaagccacctgtaacgttgaacaatcccccttcaacgac
tggttcagcggacatctcaactttcaaatcgaacatcatctattccccttgatgccgcgt
cacaactaccacctagtggccccccaagtccgttcgctttgtgcaaaatacgagattccc
tatgaagtaaagaccttgtggcgaggcctagctgacgttgtcaggtcactgaagagctca
ggagacctctggcttgatgcctatctccacaaatga

DBGET integrated database retrieval system