KEGG   Cynoglossus semilaevis (tongue sole): 103380321
Entry
103380321         CDS       T04866                                 

Gene name
cdkn1b
Definition
(RefSeq) cyclin-dependent kinase inhibitor 1B
  KO
K06624  cyclin-dependent kinase inhibitor 1B
Organism
csem  Cynoglossus semilaevis (tongue sole)
Pathway
csem04012  ErbB signaling pathway
csem04068  FoxO signaling pathway
csem04110  Cell cycle
Brite
KEGG Orthology (KO) [BR:csem00001]
 09130 Environmental Information Processing
  09132 Signal transduction
   04012 ErbB signaling pathway
    103380321 (cdkn1b)
   04068 FoxO signaling pathway
    103380321 (cdkn1b)
 09140 Cellular Processes
  09143 Cell growth and death
   04110 Cell cycle
    103380321 (cdkn1b)
SSDB
Motif
Pfam: CDI
Other DBs
NCBI-GeneID: 103380321
NCBI-ProteinID: XP_008310449
UniProt: A0A3P8VJ99
LinkDB
Position
6
AA seq 184 aa
MSDVRLSNGSPTLERTDARVSDHPKPSACRNLFGRGDPEELNADFKGQMREMEEAASAKW
GFDFASNTPLVNDMLEWELVDYRALPGFYSRPLRREKGVCSAGNNNVDLNGNHNCVLVAP
GEDSDRSDGQMEQCIPVRKRAACHEAPAQNKRSHNSSSDELSCPSLSHSTEHTPRKSNSP
KRLT
NT seq 555 nt   +upstreamnt  +downstreamnt
atgtcagatgttcgactttcaaacggtagtccgacgctggagcggacggacgcccgcgtg
tcggatcacccgaagccgtcagcctgcaggaatctctttggcaggggggaccccgaagag
ttaaacgcggattttaagggacaaatgcgggagatggaggaggctgcctcagccaagtgg
ggcttcgacttcgcaagtaacacgccgctggtgaacgacatgctggagtgggagttagta
gactacagagccctgccgggtttctactctcggccgctccgcagggagaagggcgtctgc
tccgctgggaataacaatgtggatctaaatggaaatcataattgtgtgctggtggctcct
ggcgaagatagcgacaggtctgacgggcagatggagcagtgcatccctgtgaggaaaaga
gctgcgtgtcacgaagccccggcccaaaataagaggtcacacaacagcagctcagatgaa
ctcagttgtccaagtctgagccattctacagaacacacacccaggaaaagcaatagcccc
aagagactgacgtga

DBGET integrated database retrieval system